SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011668 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011668
Domain Number 1 Region: 422-595
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-52
Family SPRY domain 0.0000427
Further Details:      
 
Domain Number 2 Region: 8-78
Classification Level Classification E-value
Superfamily RING/U-box 6.63e-20
Family RING finger domain, C3HC4 0.0046
Further Details:      
 
Domain Number 3 Region: 162-223
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000102
Family B-box zinc-binding domain 0.00075
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000011668
Domain Number - Region: 210-374
Classification Level Classification E-value
Superfamily t-snare proteins 0.0133
Family t-snare proteins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011668   Gene: ENSONIG00000009278   Transcript: ENSONIT00000011677
Sequence length 603
Comment pep:known_by_projection scaffold:Orenil1.0:GL831151.1:866892:873768:-1 gene:ENSONIG00000009278 transcript:ENSONIT00000011677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESAELFTEQELTCSICLDLFTDPVSTPCGHNFCQACIGGYWASSAVSTCPLCKHQFEGRP
QLSINKVFAQIAEKYKQTHYAPLPSPFGNGTPGAAMAGAMNTNPFLTPAPLAAQANGDVV
WCDVCTGIKQPAVSSCLTCTASYCTEHVQPHHTTPFYAKHPLMDPQEALRGRTCSVHRRL
MEVYCRTCESCICAICVLEEHRMHKTVSVQTERLSKQKQVSRTEQEILNRIKEKEIRVTE
LKKKLDNLQSYADRERGEVEHLLDDLSGSLDQIRSHVVGGIETQLDAVMTKGEGMVNRLE
EELSLLTERRAALEAQATSQDHIAFLKTYEATTAPLAEDQQAQADDDSQLVLHFQLGEVK
LALSEVKEKMEEIRTGEIRSRVSAGDMMAAESMLSLRASTASLRKSQWSLKGESQNKSGY
KKARLYMEDVTLNPVTAYPFLILSEDRKQVKRGEKLQFYRNSPHRFDVWSCILAKEGFSS
GRHYWEVCVGENKDWKLGVVSESAQRKGLFDMCPSHGYYAIWWSSSQLRALTTPPLTKVK
GHHPKLRQVGVFLDVEEGQVSFYNVKSGSEIYSFHTSTEFTERMFPLLGTGDKEVPLILL
TTL
Download sequence
Identical sequences I3JS23
ENSONIP00000011668 ENSONIP00000011668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]