SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011693 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011693
Domain Number 1 Region: 377-557
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-56
Family SPRY domain 0.00054
Further Details:      
 
Domain Number 2 Region: 10-82
Classification Level Classification E-value
Superfamily RING/U-box 3.09e-21
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Domain Number 3 Region: 146-208
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.95e-17
Family B-box zinc-binding domain 0.00078
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000011693
Domain Number - Region: 227-292
Classification Level Classification E-value
Superfamily OmpH-like 0.0248
Family OmpH-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011693   Gene: ENSONIG00000009298   Transcript: ENSONIT00000011702
Sequence length 558
Comment pep:novel scaffold:Orenil1.0:GL831134.1:1645629:1659269:-1 gene:ENSONIG00000009298 transcript:ENSONIT00000011702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQAGLLLDKDQFNCSICLDVLKDPVTIPCGHSYCSGCIQNYWDQDDYLGVYVCPQCRQN
FNPRPLLARNTILADVVEIFKNTRLHDAAAPTAGRTFAEAGDVECDVCIGLKSKAVSSCL
VCLASYCDDHVRPHYESSAFKKHKLVAASKRLQETICPRHDKLLEVYCRTDKRCICSLCL
TDEHKGHDTVLAEEEIQQKKRQLSEIKQSSQLRIQQREKEVQELRKAIFSLSHSTEAALE
ESERIFSKLIRSIEKQNSEVKELIRVQGKAAVNQAEEELEKIQKEMAELKRTGAELEKLS
HTEDHIHFLQKCKSLHFPTKSVEMPSTDALHYLMYKTTRGALVNLKDNLDETLQKEFSKI
SEKVKDADIPYNSEPKMRADFLQYYNDLILDPNTANSYLCFSDGRRAVTTRADPQPYADH
PDRFTSWAQVLCKAGMAGRCYWEIEWTGNGGVSVGVCYKNMSRAGGGSECKLGHNSKSWS
LDCSPTACSFQHNKESMTISTQCASRIGVYLDFRGGTLSFFSVSDAMVLLHKEKTTFTQP
LYPGFWVGLGSTLKLCSI
Download sequence
Identical sequences I3JS48
ENSONIP00000011693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]