SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011694 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011694
Domain Number 1 Region: 385-565
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-56
Family SPRY domain 0.00054
Further Details:      
 
Domain Number 2 Region: 8-82
Classification Level Classification E-value
Superfamily RING/U-box 2.83e-21
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 141-201
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000244
Family B-box zinc-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011694   Gene: ENSONIG00000009298   Transcript: ENSONIT00000011703
Sequence length 566
Comment pep:novel scaffold:Orenil1.0:GL831134.1:1645629:1653604:-1 gene:ENSONIG00000009298 transcript:ENSONIT00000011703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATTISVEQDQFCCSVCLEVLRDPVTIPCGHSYCLECIEDYWNGAKQKGQWSCPQCRQV
FNPRPLLSRNTVLGELVEKLQKTGFQAETQQSTKPEEVKCTSCTVRKNKAVKSCLVCVGS
YCASHLKVHEERFRGKGHKLIPPSDQLKEKLCPQHDKLLRLYCHNDQHCVCSQCVKESHK
GHETVSVVDERAKQQKKLQETSLKSVQKLKETEKELRYIIRYIKHSTEAALEESERIFSK
LIRSIEKQNSEVKELIRVQGKAAVNQAEEELEKIQKEMAELKRTGAELEKLSHTEDHIHF
LQKCKSLHFPTKSVEMPSTDALHYLMYKTTRGALVNLKDNLDETLQKEFSKISEKVTLLK
ESSKNNSEKTKVKDADIPYNSEPKMRADFLQYYNDLILDPNTANSYLCFSDGRRAVTTRA
DPQPYADHPDRFTSWAQVLCKAGMAGRCYWEIEWTGNGGVSVGVCYKNMSRAGGGSECKL
GHNSKSWSLDCSPTACSFQHNKESMTISTQCASRIGVYLDFRGGTLSFFSVSDAMVLLHK
EKTTFTQPLYPGFWVGLGSTLKLCSI
Download sequence
Identical sequences I3JS49
XP_005476541.1.78416 ENSONIP00000011694 ENSONIP00000011694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]