SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000011880 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000011880
Domain Number 1 Region: 36-156
Classification Level Classification E-value
Superfamily Hormone receptor domain 6.02e-30
Family Hormone receptor domain 0.0000346
Further Details:      
 
Domain Number 2 Region: 112-410
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000119
Family Rhodopsin-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000011880   Gene: ENSONIG00000009454   Transcript: ENSONIT00000011889
Sequence length 443
Comment pep:known_by_projection scaffold:Orenil1.0:GL831134.1:2803227:2838133:1 gene:ENSONIG00000009454 transcript:ENSONIT00000011889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTNTAGHGSVPISSRTCTLFRPEVAARTMDATIYEIIFGELGDLNCSLIEAFQDTFLEN
ASLPLLSTDGLYCNATTDEIGTCWPRSSTGRIVERPCPEYINGVKYNTTRSAYRECMDNG
TWALKSNYSNCEPILEEKRKYPMHYKIALIINYLGHCISVGALVVAFILFLCLRSIRCLR
NIIHWNLITTFILRNVMWFLLQLIDHNIHESNEPWCRLITTIYNYFVVTNFFWMFVEGCY
LHTAIVMTYSTDKLRKWVFLFIGWCIPCPIIVAWAIGKLYYENEQCWFGKEPGKYMDYIY
QGPVILVLLINFVFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFV
NPGEDDISQIVFIYFNSFLQSFQGFFVSVFYCFLNGEVRSAVRKRWHRWQDNHALRVRVA
RAMSIPTSPTRISFHSIKQTTAV
Download sequence
Identical sequences I3JSN5
ENSONIP00000011880 ENSONIP00000011880 XP_019202895.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]