SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012118 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012118
Domain Number 1 Region: 613-658
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000291
Family Ovomucoid domain III-like 0.0056
Further Details:      
 
Domain Number 2 Region: 700-738
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000929
Family Ovomucoid domain III-like 0.021
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000012118
Domain Number - Region: 744-774
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00319
Family Ovomucoid domain III-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012118   Gene: ENSONIG00000009646   Transcript: ENSONIT00000012127
Sequence length 952
Comment pep:known_by_projection scaffold:Orenil1.0:GL831383.1:262161:337992:1 gene:ENSONIG00000009646 transcript:ENSONIT00000012127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLCFQITSFLLAVNFYSRPVRAQDPSCCHHAAEFSPCREACDQLTTIKSESRLKHLLQR
LPGYCSESMNELWMCINSTLPGVSRKSEGWVGLGCCELAITTECRKECKQASSKNDITKV
CKKTTENSLYSCITKNEMGSTCCSYAGRHTTCREYCQAIFRTDSTPTVSQISAVKDYCQT
HSAQLIHCVNNFTKSYPIHSPVDSLYCCDRAATHCQMACRQILRTMSTEHEIMEGLIKEC
GSQPLPQEPMWQCFLSSVQTPSITPEDNLPAKMDCAKLHCCSKANTSLCRDMCLEISSNW
GSQTWQDFDQLCEYNPVETELINCLADVREPCQLGCKDLTYCTNFNNRPTELFRSCNIQS
DQGAMNDIKLWSNGTIKMPFMNIPVLDIRKCQPHMWKAVACSLQIKPCHSRSRGSVICKS
DCVDILTQCGDTKRFHEGQTPERICELLSPIDDPEHCIPLYKYLTPSSLGTNTVEEVIHP
CNPNPCPSNHICQVNRKGCLDELNCQPYLCVPGCKMGEASEFLVQQDARIQVPTRTDPTV
CFEVCSCGPSGRLENCVEMPCMDTSKPCIVGGQRKSHGTSFKTDCHNCYCFAGETVCSTK
ECLSSGYTDDSHRHFTGLPCSCQDRFVPVCASNGRTYPSACVARCMGFKDSQFVFGPCHL
SKPCASKPCQRNQRCIPKYRVCLSDVSDCPQYECIGHAATCDKNSEDPACDTEGMDHRSL
CHLHQAGKTLAYMGRCQEACRKPKQVCGHNGETYNTVCGAYSDRVAVDYEAPCRAVGAVS
DVAPDSACSLVSCPSLSTPGCHPVTPPGACCPICASILQILWSKERMNTFSKLNKKQPVT
VHDVLQILRPHISVPQCDVFGYLSIDHLLVVIIAPVDQQPTPLQIEACSKEAEKIDSLIN
YASPTLVSHVPLSAFLTTEIKTSSIRSSGSTPSSPLTPALCFLLGLLVTPAP
Download sequence
Identical sequences I3JTC3
ENSONIP00000012118 ENSONIP00000012118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]