SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012430 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012430
Domain Number 1 Region: 373-544
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-47
Family SPRY domain 0.00059
Further Details:      
 
Domain Number 2 Region: 9-81
Classification Level Classification E-value
Superfamily RING/U-box 3.95e-21
Family RING finger domain, C3HC4 0.0088
Further Details:      
 
Domain Number 3 Region: 143-208
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000183
Family B-box zinc-binding domain 0.00088
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000012430
Domain Number - Region: 201-288
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0214
Family HBL-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012430   Gene: ENSONIG00000009891   Transcript: ENSONIT00000012439
Sequence length 552
Comment pep:novel scaffold:Orenil1.0:GL831554.1:169655:171805:1 gene:ENSONIG00000009891 transcript:ENSONIT00000012439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQGFKLDEEKFFCSICLDLLNEPVTTSCGHSFCKSCIRNHWDAEDQKGTYTCPQCRQA
FMSRPVLGKNTMLADLVEELKKNVVQAAPHPQHYAEPGDVACDVCTERKLKASKSCLQCM
ASYCELHLQPHYESPNFQRHKLVEALAKLQENMCSVHSKVKELFCHSDQQCICSVCAMEE
HSGHDTVSAIAERTERQRELGPRWQKIQQRIQDREKHMKLLQQQMEAIASSADKAMRDTQ
TMFNQLHRLVEKRSSDVQQQIRFQQQTELSRAKELQKKLQQEVTDLRRRDAELEQLSRTE
DHGQFLLSYPLLLGLSESTHSASINIHPQSYFQEVTAAVSELVNKLQCILSQDWSEVSLT
EGETLSPVEPKTRDEFLQYSQHITLDPNTVNKGLELSEGNRKVTWINKIQSYPDHADRFI
DTFQVLSRESLTGRCYWEVKRTRSVSVAVAYRSISRTGSGSVFGDNDKSWATYCCLSKYE
FKHDSIVTFLSGLRSSTVGVYLDHSAGILSFYSVSETMTLLHRVQTTFTQPLHAGLWVGF
GSSAELVSTSVV
Download sequence
Identical sequences I3JU85
ENSONIP00000012430 ENSONIP00000012430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]