SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012656 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012656
Domain Number 1 Region: 313-590
Classification Level Classification E-value
Superfamily Kelch motif 3.66e-72
Family Kelch motif 0.0000232
Further Details:      
 
Domain Number 2 Region: 46-161
Classification Level Classification E-value
Superfamily POZ domain 3.45e-34
Family BTB/POZ domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012656   Gene: ENSONIG00000010064   Transcript: ENSONIT00000012666
Sequence length 600
Comment pep:known_by_projection scaffold:Orenil1.0:GL831134.1:7966512:7984683:1 gene:ENSONIG00000010064 transcript:ENSONIT00000012666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLMLGRRLNREDSGIRDSPAVKRKVFEVESKNIASQDVLDFCSGSSHSEGILQVFNEFR
DCRLFTDVVISVQGREFPCHRAVLSACSSYFRAMFCNDHRESREMLVEINGILAEAMESF
LNYVYTGRAKITTENVQFLFETASLFQITTLRDACAKFLEDQLDPCNCLGIQRFAEAHSL
KQLASRCQSYALANFSEVALHEEFLDLRKEELEEYINSDELSVCKEEFVFEAVMRWVYYS
VEARKPILKALLHHVRLPLLHPSYFVQTVEGDQLIQTAPECYHLLHEARRYHVLGNEMMS
PRTRPRRSTGYSEVIVVVGGCERVGGFNLPYNECYDPVTGEWKSLAKLPEFTKSEYAVCA
LRNDILVSGGRINSRDVWMYNSQLNLWIRVASLNKGRWRHKMGVLLGKVYAVGGYDGQSR
LSSVECYDSFSNRWTEVAPMKEAVSSPAVASCAGKLFVIGGGPDDETCSDKVQCYDPETD
SWLLRASIPIAKRCISAVSLNNLIYVCGGLTKSIYCYDPAEDYWMHVAQTFNKQESCGMS
VCNGKIYILGGRGENGEATDTVLCYDPATGIMTGASSMPRAISYHGCVTIHRYNDKYFKS
Download sequence
Identical sequences I3JUW1
ENSONIP00000012656 ENSONIP00000012656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]