SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012717 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012717
Domain Number 1 Region: 305-585
Classification Level Classification E-value
Superfamily Kelch motif 1.07e-78
Family Kelch motif 0.00000115
Further Details:      
 
Domain Number 2 Region: 33-149
Classification Level Classification E-value
Superfamily POZ domain 1.63e-34
Family BTB/POZ domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012717   Gene: ENSONIG00000010113   Transcript: ENSONIT00000012727
Sequence length 591
Comment pep:known_by_projection scaffold:Orenil1.0:GL831212.1:1806059:1812912:1 gene:ENSONIG00000010113 transcript:ENSONIT00000012727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRICTVPLRCTRLCPHSLDKEDGVERHGPVTLNPRHMRKAFKVMNELRSQSLLCDVTIVA
EDVEIAAHRVVLAAGSPYFHAMFTGEMAESRAKRVRIKEMDGWTLGLLIDYIYTAEIQVT
EDNVQALLPAAGLLQLNEVKKACCEFLSSQLHPSNCLGIRAFADLHACSQLLTQANSFAE
QHFTEVVGSEEFLNLGMEQVSSLIASDKLTIPSEEKVFEAVIAWVNHDKDVRQEHLAHLM
EHVRLPLLSREYLVQRVEEESLIKNSSACKDYLIEAMKYHLLPADQRALMKTARTRMRTP
ACCPKVMVVVGGQAPKAIRSVECYDFEEQRWYQVAELPTRRCRAGVVYVAGCVYAVGGFN
GSLRVRTVDCYDPMMDRWTSVSSMQDRRSTLGASVLNGLLYAVGGFDGSTGLSTVEAYNA
KTDEWFHVAPMSTRRSSVGVGVVNGILYAVGGYDGATRQCLSTVEAYNPKSNTWSYIAEM
GTRRSGAGVGVLKGLLYAVGGHDGPLVRKSCEVYDPATNSWRQVADMNMCRRNAGVCAVN
NVLYVVGGDDGSCNLASVEFYNPITDKWTLLPTCMSTGRSYAGVTVIDKPL
Download sequence
Identical sequences I3JV22
ENSONIP00000012717 ENSONIP00000012717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]