SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012798 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012798
Domain Number 1 Region: 348-529
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.72e-51
Family SPRY domain 0.00029
Further Details:      
 
Domain Number 2 Region: 4-71
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000754
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 138-200
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000121
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012798   Gene: ENSONIG00000010177   Transcript: ENSONIT00000012808
Sequence length 535
Comment pep:known_by_projection scaffold:Orenil1.0:GL831145.1:6154205:6156381:-1 gene:ENSONIG00000010177 transcript:ENSONIT00000012808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HRAMGTMEETLKCPVCQDFFIDPVTLQCGHDFCLTCIQAVWETDVSDEGPFFCPECQIFL
PSDLTLKVNADLQTKVKDFTTKTLETKSSSAICCDQCIEMPSVAIRTCLTCDASLCQAHA
LLHQQRSALREHTVVEVTSDPLSLKCREHRDELKLFCMEEKVPVCCLCVLVGTHKHHKAS
QLHEAKADFKSMLETTMNQLLKRRSEAEHAIKDLESLYTQTVTSAAEFRERISDKYSRIH
VVLNGDERLMMQIIDAEETCMTEWLEAQRSIVEAQIKEIDAFRASSKSLLQETNDLRFLQ
QMTSQNLCDPLDFAPIQEVNRDLCDPEKLRTVERLVDELSVALSQHFPRMWSYLSSPVLD
FKTAHPKLELSQDRKQVYWRRQPFGEGQNPQPYDSQYSVLAQESFTGGQHYWEVIVQDKP
FWMIGVTTGSVDKKSSSSLGVNNTSWCIYHGDGQYLACHDTQEKQLSVGKRVRKLGILAN
LQKGELSFYDADAMRLLHSFCVQYTEPLYPIFNPCIDMNGVNTQPLTLFWIKDPW
Download sequence
Identical sequences I3JVA3
ENSONIP00000012798 ENSONIP00000012798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]