SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000013173 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000013173
Domain Number 1 Region: 371-541
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-42
Family SPRY domain 0.0024
Further Details:      
 
Domain Number 2 Region: 9-75
Classification Level Classification E-value
Superfamily RING/U-box 1.13e-16
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 3 Region: 140-204
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000214
Family B-box zinc-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000013173   Gene: ENSONIG00000010479   Transcript: ENSONIT00000013183
Sequence length 545
Comment pep:novel scaffold:Orenil1.0:GL831185.1:3637081:3639826:1 gene:ENSONIG00000010479 transcript:ENSONIT00000013183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESCEVLHSFSCSICLDVLKNPVTLHCGHSYCMDCINGCFDQEDQSGIYSCPQCRHTFN
PRPVLKKNTVLVDLMVKMSVRAQTNMRVKDEAGPGDVECDFCTVRKLKAVKSCLVCLASY
CATHLQPHYKSAAFKRHKLVEVSASIQEKICSKHDKLLEVYCRSDGQCICLLCVMDEHKG
HDTVSAAAERKEKQKQFGKKKQRIQQGIQEKEKQLRQLRQKTKGLKASSDAAVAQNEKAY
AEIVLKADKRRCAVNDLIRDQEKAALSRTEELVDRLEKEISELRKQEDQLKQLSLTEDHI
NFLQHCQTIFDSTEPDVSSDVNLQLHTPFDFVTKAISDLRDKMESVAKCIAQISETSFVL
LVQVDPDPKTREEFSMYSCCIALDPNTAFENLLLSDGNTKVTWVKNPQRYPYHPDRFTIC
TEGLSGVCYWEVEWKGPRVEVALCYKGTELEESGFGYTDQSWCISLSSSCCAFWHNEVKT
RISIPCSSTVGVYLNHKGGSLSFYSVSDSGQMVLVHRVQTKFSQPLYPGFMVSRGASETL
RILKF
Download sequence
Identical sequences I3JWC8
ENSONIP00000013173 ENSONIP00000013173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]