SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000013189 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000013189
Domain Number 1 Region: 13-91
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1.57e-17
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000013189   Gene: ENSONIG00000010491   Transcript: ENSONIT00000013199
Sequence length 605
Comment pep:known_by_projection scaffold:Orenil1.0:GL831134.1:10838043:10843603:1 gene:ENSONIG00000010491 transcript:ENSONIT00000013199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTVSATPQQMRERLLQAIDSQSNICNMVVVLEVIACLEKYPITKEALEETRLGKLINDV
RKKTKDEDLAKRAKKLLRNWQKLIEPGPPVAASVPGSTNGSSHPCRTDASPSDISVPGKG
VPEVKIRNDVHNTYSPKAEKSSSRKRRAEHRDSGVYLQEKISKMSPYDNSVSTPPTNGIA
GSPDALPDQEVVPSPDRSRVEHLDNDKMNRIPVNAVKPRPSSPGVAKLPSTSSLIKVAVM
QQQARLDEGGGGYYQARSPRGLTTSPRSTKQDTMTKRSSAYAPKGTPVPSPSSRDSPLSF
SHTVSSPASSYADKLPHSSNRSSMHWASSSEASSLCPSQDISATLESPSVSPSPSLSQQN
SEPHRQMSEGAMVVSDDADGTTVPNSEHKRRKYRSRDYSVNLDGQKMEDTTKPVRLKERR
LTFDPVTGQIKPLVHKEPSQTDEAPTPDPPESRQRTESTVQQCTATTAVPGPSPNPFHHT
NWKELSRNEIIQSYLNLQSNVLNSSGVQAPSAHFFMSEYLKREEQEIKESRKMHVLQTDN
LTGDLPGVSRDVTDEDLDRIHTQHWQGVNGVFDTKGTWYDWTDCISLDPHGDESKLNILP
YVCLD
Download sequence
Identical sequences I3JWE4
XP_003437811.1.78416 ENSONIP00000013189 ENSONIP00000013189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]