SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000013290 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000013290
Domain Number 1 Region: 338-426
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 4.58e-33
Family Small-conductance potassium channel 0.00011
Further Details:      
 
Domain Number 2 Region: 205-377
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.06e-25
Family Voltage-gated potassium channels 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000013290   Gene: ENSONIG00000010570   Transcript: ENSONIT00000013300
Sequence length 480
Comment pep:known_by_projection scaffold:Orenil1.0:GL831431.1:139638:165791:-1 gene:ENSONIG00000010570 transcript:ENSONIT00000013300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMTNRSLHGDSKVDCVSCDGLISRNCGDSADVSVPLTLPGKRTTHMEGDDLYRLRDRKL
LLEDKKRLCAWALGTALFGILLMIIHAEICPYVYTPGSNIALIINCSISLSTGCLLILIT
AFHYKDIQLFIIDHNQVDWRIAMTSHRIIVITLELLVCVIHPVGSYWGVGLHVNSSSTVP
TPSPLCVSSHHGEALMDMELLLSVLMFLRLYLVHRAILLHSKVLLSASYRSIGSLNNINF
TFRFVLKVLMNKHPARMLLVFILFFWLTVSWMLTLCERQTKESTGHMDTALWLIAITFLT
VGYGDVAPKTNCGKAVCLFTGVMGVACTAMLVAIVTEKLALNKGEKHVHFFMMDIQISKR
IRHAAANVLRECWLLHRANVTKGNRGEHRKHQRCLLEAIRVFRHLRLKQRKLRDYVSEMV
DLPKMQMIMCDLSANWNNSYRELEQRILSMEQKLDELSRCFQQTSDLLSQAVRHRNPEIR
Download sequence
Identical sequences I3JWP5
ENSONIP00000013290 XP_003458467.1.78416 ENSONIP00000013290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]