SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000013537 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000013537
Domain Number 1 Region: 355-512
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-38
Family SPRY domain 0.00018
Further Details:      
 
Domain Number 2 Region: 17-86
Classification Level Classification E-value
Superfamily RING/U-box 9.42e-19
Family RING finger domain, C3HC4 0.0036
Further Details:      
 
Domain Number 3 Region: 139-203
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.45e-17
Family B-box zinc-binding domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000013537   Gene: ENSONIG00000010767   Transcript: ENSONIT00000013547
Sequence length 522
Comment pep:novel scaffold:Orenil1.0:GL831139.1:2318545:2320605:1 gene:ENSONIG00000010767 transcript:ENSONIT00000013547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IYPPSVVMAAASCLLSEDQFLCCICLEVFTDPVSTPCGHNFCKNCITQHWNSSPLCQCPV
CKRKYYTRPELHVNTFISEMAAQFKLSEQQSAKPGEVLCDVCTGTKLKALKSCLVCLTSY
CETHLQPHQTVSGLKRHQLIDPVKNLERRICSKHDKLLEMFCKSDQMCVCVVCSVSDHKR
HDVVPLKEEYKVKKAGLVKKQAEIQGMILKRLEKVQEVKRSVQLSKEEADRELEGGVQFF
ADLMESIEIGLNELTEAVKEKQRTAEKQAADFIKELEQEIFELTKRSSEMDQLSSSEDHL
QFIHNFSSVKTVPPTKDWTNTSIHPPSYEGMVVRAVSQVEKKLNDQMKSLFEDELKRVQW
YRCYAMLDPDTVHPRPPQYKGNDCRCVLSNLGYSSGRFYFEVKVDKWSTWTLGVTRKDNV
KGQVQLSSSNGFWTLCLCSDGYVVSTEPAVHLSLRSKPEKVGVYVHYDEGLVCFYDVSTA
ALIYSFSDCSFTEKLYLFFSPCSNDGNNIHTALLFQPSQINK
Download sequence
Identical sequences I3JXE2
ENSONIP00000013537 ENSONIP00000013537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]