SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000013718 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000013718
Domain Number 1 Region: 399-582
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-67
Family SPRY domain 0.00000774
Further Details:      
 
Domain Number 2 Region: 12-85
Classification Level Classification E-value
Superfamily RING/U-box 1.3e-20
Family RING finger domain, C3HC4 0.0072
Further Details:      
 
Domain Number 3 Region: 169-232
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000214
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000013718   Gene: ENSONIG00000010902   Transcript: ENSONIT00000013728
Sequence length 586
Comment pep:known_by_projection scaffold:Orenil1.0:GL831609.1:72351:103988:1 gene:ENSONIG00000010902 transcript:ENSONIT00000013728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMSLPAAFLSEDQFTCSICLEVFNKPVTTPCGHSFCQTCISSYWDGSKRSAKTYQCPLC
KESFLKRPELHINLTLKEITEQFKQMASSPVAERLGGMEPSRSPSHHNQPLSPGFQRQRE
MPENIFAEMMSRFQRLPDPGLNHAPLPQSQSRDGAPFVRTEHHDPPPPYPSDSDLPPCPI
HLRGLEFFCRTDNVCVCSTCVETSDHLGHNITPAKREWHLKKAQLGITEAELKELISERE
RKVEEIHSSLREIKDAVERETDGAVCAFSKLISSVEHCQAEVLEVIEMTLRAAEHRAQSM
LRELEEEIAELKRRSTTLSQLALSEDYIFFLKTYPALSAPRQAKNWSGVSVSSQLTSGVI
LRSVNQMMEQFHKELRILPEICQQASSNQSLSRPNPKVRRVQEYTVDITLDPTTAHPRLT
VSADGKRVHCGDRHQVVPDNLKRFDRVVCVLANQGFNSGRHYWEVEVGGKTDWDLGVASR
SINRKGKITVSPAHGYWFLSLRDQSEYAFRTEPSTNLTVHIRPSRVGIYVDYDKGLLSFY
NVDAKVLMFTFTDSFSDTIHPFFSPCTNKSGRNEAPLIICPVAMTE
Download sequence
Identical sequences I3JXX3
ENSONIP00000013718 ENSONIP00000013718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]