SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000013719 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000013719
Domain Number 1 Region: 371-549
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-64
Family SPRY domain 0.00001
Further Details:      
 
Domain Number 2 Region: 10-83
Classification Level Classification E-value
Superfamily RING/U-box 1.17e-20
Family RING finger domain, C3HC4 0.0072
Further Details:      
 
Domain Number 3 Region: 140-202
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000336
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000013719   Gene: ENSONIG00000010902   Transcript: ENSONIT00000013729
Sequence length 550
Comment pep:known_by_projection scaffold:Orenil1.0:GL831609.1:75786:102682:1 gene:ENSONIG00000010902 transcript:ENSONIT00000013729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLPAAFLSEDQFTCSICLEVFNKPVTTPCGHSFCQTCISSYWDGSKRSAKTYQCPLCKE
SFLKRPELHINLTLKEITEQFKQMASSPVESYAHRGDCCCDEVSGCAVFTKSSVILRYLV
CMTSCSYRLISHIYSNVDMSSDSDLPPCPIHLRGLEFFCRTDNVCVCSTCVETSDHLGHN
ITPAKREWHLKKAQLGITEAELKELISERERKVEEIHSSLREIKDAVERETDGAVCAFSK
LISSVEHCQAEVLEVIEMTLRAAEHRAQSMLRELEEEIAELKRRSTTLSQLALSEDYIFF
LKQAKNWSGVSVSSQLTSGVILSWNEFSNKHKVCTELRQSFDRILTGKWLRVSGSERVLY
RMGVSKKKEVRRVQEYTVDITLDPTTAHPRLTVSADGKRVHCGDRHQVVPDNLKRFDRVV
CVLANQGFNSGRHYWEVEVGGKTDWDLGVASRSINRKGKITVSPAHGYWFLSLRDQSEYA
FRTEPSTNLTVHIRPSRVGIYVDYDKGLLSFYNVDAKVLMFTFTDSFSDTIHPFFSPCTN
KSGRNEAPLI
Download sequence
Identical sequences I3JXX4
ENSONIP00000013719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]