SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014835 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014835
Domain Number 1 Region: 28-136
Classification Level Classification E-value
Superfamily PH domain-like 1.85e-36
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000108
Further Details:      
 
Domain Number 2 Region: 212-280,337-365
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.83e-28
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000686
Further Details:      
 
Domain Number 3 Region: 373-478
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.83e-18
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014835   Gene: ENSONIG00000011783   Transcript: ENSONIT00000014847
Sequence length 491
Comment pep:known_by_projection scaffold:Orenil1.0:GL831167.1:4422382:4443930:-1 gene:ENSONIG00000011783 transcript:ENSONIT00000014847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPIMSGHPPPRRQTNVGSTLLSSQENECLFNHLGRKCITLSSGVVQVFTADRSSSWNKKC
CGVACLVKDNPQRSYFIRVFDIRDGKVMYEQELYNNFNISVPKPYFITFAGDTCQVGLNF
SSEEECKRFRNSAGELMGRKQRKTEKRRDPANGPALPMATVDIKNPEINSVQRYHNNSQM
NNIVHSSFPKREKKVKGGKKKKLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNL
FDMCGISEAQLKDKETSKVIYDFIEKNGGVDAVKDELRKQGPPSWMCCRLSGDIPAVCHS
FGKKNPPPVICKKAAPSLNSVIAWLCARGPAPPPPPPSRGGPPPPPPHHGSAPPPPXPPP
GPPPPPGPPPPAPPLATEANGGDSSLPASGNKSALLSQIRDGTQLKKVEQKERPASNVGR
DALLDQIRQGIQLKTRDDNNDSAPATPAPSSGIVGALMEVMEKRKRAIHSSDEDDDDEDD
EDFEEEDEWDD
Download sequence
Identical sequences I3K140
ENSONIP00000014835 ENSONIP00000014835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]