SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014956 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014956
Domain Number 1 Region: 376-548
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.97e-39
Family SPRY domain 0.0017
Further Details:      
 
Domain Number 2 Region: 9-80
Classification Level Classification E-value
Superfamily RING/U-box 1.39e-19
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 143-208
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000113
Family B-box zinc-binding domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014956   Gene: ENSONIG00000011881   Transcript: ENSONIT00000014968
Sequence length 559
Comment pep:novel scaffold:Orenil1.0:GL831391.1:553304:555006:-1 gene:ENSONIG00000011881 transcript:ENSONIT00000014968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IHTGQKMDQEKLCCSVCLDLLKKPVTLPCGHNYCMSCIKVHWDKEDPKGAYSCPQCRKVF
APRPELVKNTMLAELVEDLKTPGIQPASADLCYAGPEDISCDVCTGKKLKAVKSCLVCLV
SYCEQHLQPPHYDSSAFDSHKLVKPSNRLKGNICSTHNEVMKMFCHTDQKCICYVCCVNE
HNHHNTVQVEEERKHRQKDLKLILQKIQQRIQRRVEEAKVLDKEVEGIKVSADKAMKDSE
TIINQLVSYIKEKGTSLKQQIQLQQKEEESRVIELQKKLEQEITELKKMDEELKQLLHTE
DNTEFLLSYSLPFKLNDYTDSPSFKMCPVKYFEDFQTALLEIRDNLKAILAQEWRKITLT
VRSVDVLLPQSKPKTRDEFLKYSCQLTMDSDTVHPKIFLSNQNRSVSNTVQHPTNDFYFH
RRDRFSNQQQVLSKESLIGPCYWEVEMKGRGLSVAVTYKNKNNLDQSEFGSNNNSWALEC
YGDCYKFRHNKITTSLSGPLSSKVGVYVDPRAGILSFYSVSDTMALLHRVQTTFTEPLYA
GLWIWKSFWTDTTATFNEI
Download sequence
Identical sequences I3K1G1
ENSONIP00000014956 ENSONIP00000014956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]