SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015089 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015089
Domain Number 1 Region: 382-554
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-50
Family SPRY domain 0.00061
Further Details:      
 
Domain Number 2 Region: 10-81
Classification Level Classification E-value
Superfamily RING/U-box 2.02e-19
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 147-210
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000198
Family B-box zinc-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015089   Gene: ENSONIG00000011987   Transcript: ENSONIT00000015102
Sequence length 570
Comment pep:known_by_projection scaffold:Orenil1.0:GL831144.1:1662995:1670618:1 gene:ENSONIG00000011987 transcript:ENSONIT00000015102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SIMSAKLWTEEQFNCPVCLDLPNDPVTIPCGHSYCMACIKDYWTKDDPKGIYSCPQCRQT
FCPKPSLSRNTMLAEAVEQLRKGALKSEVRESMRLAKGKLSSSVVPCDMCKNEKRAAVKS
CLVCMSSYCEAHLKPHQTKKSLKQHELIPPTGNLAEKICTQHKYLQEFFCRQCKMFICWL
CTSNQHKGHESVSTKVERLEKQKLLSDLQSANQQKLKEREQELKDMKKMMEQMKRSADVV
HNEAEQALSELLRSMERLQELLEEVMDQANQEKMGHAQEVTDSLEAEIKELKKRDTEMKD
LASCEDNIYYLQTYESMCSPLESGDLPAVKVNHEASFEPVRDAILGLRERVEDLCNQELG
KITKKVREISLDSIQAPEPRTREEFLQYSVSLTLDSNTAHRRLTLSENNTKATLQGTAQL
YPESPQRFDGWTQVMCDSPLYAQRCYWEVEWRGRGSSTGIAYGAMARKGSDARSGLGYNA
QSWTLELSDTCCTAMHDNQKKDIPVVYCPRVGIYLDLSAGTLSFYSVAESMTHLHTFRAN
FTQPLYATFWVGSGIGVGLDFSSGSESIKI
Download sequence
Identical sequences I3K1U4
ENSONIP00000015089 ENSONIP00000015089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]