SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015155 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015155
Domain Number 1 Region: 272-507
Classification Level Classification E-value
Superfamily SIS domain 2.35e-19
Family mono-SIS domain 0.0023
Further Details:      
 
Domain Number 2 Region: 7-155
Classification Level Classification E-value
Superfamily SIS domain 0.00000142
Family mono-SIS domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015155   Gene: ENSONIG00000012041   Transcript: ENSONIT00000015168
Sequence length 585
Comment pep:known_by_projection scaffold:Orenil1.0:GL831144.1:2399129:2414768:1 gene:ENSONIG00000012041 transcript:ENSONIT00000015168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YEPSLPVSEKSNPLTRDIDQASAYSIVKMLQLCDSQMFQEEAGTAYQRLLSDQVVKTLME
VAKRVAVIIKDPQESCVVMSGCGTSGRLAFLISSGFNKALSQLNQSKVYSYIIAGGDRAL
LSSQEAPEDDPRLGVLSLKKVCEGKKRVLFIGISCGLSAPFVAGQLDFCLQHPEVYMPVL
VGFNPAHQARDEPIQDCTFTFHSVVQRMQELAKSQKAFLINPAVGPEAISGSSRMKGGSA
TKILLEVAFSAAHAATFSNTPITYNGVLEHMKAYERTLDVTYSQTDGITTLVEAAGQSLR
CSRHVYYLGWGSLALLGLIDASECTPTFGAVSHRNYVRGFISGGYRELNNNDGPLTSLGP
KFSIAHEDFLHLILPCLTDKDTVLLIYTHPDDATEVGNMARRVREKTPNLHAVYHQADGD
TAASLQQDDIKKLCLSTLKITWPREALASGTLQHMQRELSTKLVLNAVSTGAHVLKGKIY
QNHMIDLQVTNTKLYRRATRLLQKLSACPEENCEEALLKAIYRVDMLTVEMTSSDITTHT
CFARNSTKVVPLALVILLTSWSLMEAESHLKQQPIVREAVAQWMW
Download sequence
Identical sequences I3K210
ENSONIP00000015155 ENSONIP00000015155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]