SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015743 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015743
Domain Number 1 Region: 339-524
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-69
Family SPRY domain 0.00000224
Further Details:      
 
Domain Number 2 Region: 10-79
Classification Level Classification E-value
Superfamily RING/U-box 2.7e-20
Family RING finger domain, C3HC4 0.0078
Further Details:      
 
Domain Number 3 Region: 143-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.29e-17
Family B-box zinc-binding domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015743   Gene: ENSONIG00000012505   Transcript: ENSONIT00000015758
Sequence length 528
Comment pep:novel scaffold:Orenil1.0:GL831271.1:340876:342560:1 gene:ENSONIG00000012505 transcript:ENSONIT00000015758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAASSLRSEDQFLCSICLDVFTDPVSTPCGHNFCKNCITQYWDTNQRCQCPMCNETFNT
RPHLRVNTFISEMVAQFKCEVQQKASSSSSEQQAAKPGEVPCDICTGTRLKALKSCLVCQ
ESYCQTHLEPHLTKKGLKKHQLIEAVEKLEGRMCKKHDKPLELFCKSDQTCVCMLCSVSD
HKNHKFIPLREEYEGKKAELEKTEAEIQQMIQKRRLKIQXQVFTALKESVDRGLKELIKE
IEDKQETTEKQAEGLIKDLKQEISELKKRSSEVEQLSHSEGLVHFLQSFSSLKAAPPTKN
WTEVSIHPPSYEGTVVRAVAQLEETLRKLRKKKLSEAELKRVQQYAVDVTLDPDTASPVL
ILSDDGKQVHCGDVKKNLPDNPERFSYCVNVLGKQSFSSGRFYFEVQVKGKTKWDLGVAR
ESINRKGKITATPQNGFWTVALRNGNEYKALTDPSVPLCLQSGPEKVGVFVDYEEGLVSF
YDVGAAALIYSFTGCSFTHKLHPFFCPCLSDGGNNSAPLIICPVNQTE
Download sequence
Identical sequences I3K3P8
ENSONIP00000015743 ENSONIP00000015743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]