SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016031 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016031
Domain Number 1 Region: 352-456
Classification Level Classification E-value
Superfamily SRCR-like 4.45e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000762
Further Details:      
 
Domain Number 2 Region: 67-173
Classification Level Classification E-value
Superfamily SRCR-like 3.01e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 3 Region: 488-590
Classification Level Classification E-value
Superfamily SRCR-like 6.54e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 4 Region: 196-302
Classification Level Classification E-value
Superfamily SRCR-like 1.07e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000603
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016031   Gene: ENSONIG00000012737   Transcript: ENSONIT00000016046
Sequence length 591
Comment pep:known_by_projection scaffold:Orenil1.0:GL831331.1:167571:178924:-1 gene:ENSONIG00000012737 transcript:ENSONIT00000016046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASQGALRGQRVVESECRCWNPAVWLLVSLLGTLVLVAISILLRLGDIKISRRALPASGV
QSPVRTEYQVQLVNGRSRCEGRVEVQYNGSWGTVCDDDWDMVDANVVCRQLGCGVAVAVS
SSSKFGQGTGLIMLDNVDCKGSEMELSQCCSLGWGIHNCYHYEDVGVTCREPTLPGSRGF
EEPSTPPQSISGLRDGTIRLVNGQNSCQGRVEIFYQGNWGTVCDDDWVLNNAKVVCQQSG
CGSAVSAHANSYFGYGTGLILLDNVNCQGTEQDLTKCKSLGWGKHNCGHHEDAGVTCTGT
LRTVILAIPSSINNRNKSSPTTTQKVPVTKSPSTTTTVTTTTTTTQTKVTSAIRVINGNS
SCQGRVEVLYKNVWGTVCDDDWDMPNAKVVCRQLGCGAPIAAKSNAYFGHGSGPILLDNV
ECSGFELELSQCFHLGWGQHNCGHHEDAGVICAPFDPQFFDLASAREFRVTETIPTTTTT
TTQPPEGMVRLMGGQHRCEGRVEMYLNSGWGTVCDDAWDLPDAQVVCRQVGCGEAIAARG
EAYFGPGMGTILLDNLKCRGTERSLQSCSHISWNVHNCDHSEDAGVTCLPS
Download sequence
Identical sequences I3K4I6
ENSONIP00000016031 ENSONIP00000016031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]