SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017095 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017095
Domain Number 1 Region: 26-198
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-68
Family Ephrin receptor ligand binding domain 0.00000138
Further Details:      
 
Domain Number 2 Region: 655-927
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.6e-66
Family Protein kinases, catalytic subunit 0.00000002
Further Details:      
 
Domain Number 3 Region: 326-515
Classification Level Classification E-value
Superfamily Fibronectin type III 6.02e-30
Family Fibronectin type III 0.00032
Further Details:      
 
Domain Number 4 Region: 950-1025
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.16e-19
Family SAM (sterile alpha motif) domain 0.0005
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000017095
Domain Number - Region: 255-318
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000288
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017095   Gene: ENSONIG00000013593   Transcript: ENSONIT00000017110
Sequence length 1027
Comment pep:novel scaffold:Orenil1.0:GL831186.1:1134104:1291674:-1 gene:ENSONIG00000013593 transcript:ENSONIT00000017110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLRKTLISVLWILLLNEVKDYNAEEVVLLNSKETQAELGWTSYPPNGWEEISGVDEKYK
PIRTYQVCNVMEPTQQNNWLQTGWVARRGGQRIFVELQFTLRDCNSIPGVAGTCKETFNL
LYVESDRDLGGVTREDRYTKIDTIAADESFTQGDLGERKMKLNTEVREIGHLNRKGFHLA
FQDVGACVALVAVRVYYKRCLATVQNLAVFPDTVAEAAFATLVEVRGTCVNNSEVDTDSP
PRMHCSAEGEWLVPIGKCSCSAGYEEGHSSCEACPPGSYKMSSRQQECFPCPANSVAEEE
GSMVCLCEEDHFRTPLDNPSAPCTRPPSPPRDLTYTLKQSTLILDWAAPSDTGGRVDLTY
SVGCRKCIGRQCEPCGASVGFVPQQVGLTERTVTVVNLLPNTNYTFTVEALNGVSELLPN
KRFYTQVNVSTSLPAPSLISELRAEKIEQKSITLVWREPSYPNSSRTGYEVKYYEKEQKD
QSYSTVKTAATRISVNNLKPGTTYVFLIRPFSTPAPSSALSSSPLSSSSSSSTSSSSSTS
SSSSSSSSSSSSPPPIDYGAYSTPLELQTLGELALASSEQNPVVIIVVVSVAALIMLLSM
GVGLLIWRRQCGYSKASQEGDEELYFQFKIPTRRTYIDPETCEDLLQAVHAFAKELDNSS
IKIERIVHTGDFGEVCRGCLKLPSKRELPVAIKTLRAGCSDKQRRSFLSEAGILGQFDHS
NIIRLEGVITTGNTMMIIVECMSNGALDSFLRKHEGQLSIMQLMDMLTGVASGMKYLTEM
GFVHKRLAAHKVLVNSNLGCKVSGFRPLQEDKIEAIYTTLHGGKSVVLWTAPEAIQYHRF
SSASDVWSFGIVMWEVMSYGERPYWDMGNQDVIKAIEDGFRLPAPVNCPPHLHQLMLDCW
QKERTERPSFSQIHSALSKSIRSPDGIGSSTLARRTLSSSITLADRPLPTFPSFNSVGEW
LDAVDMGRYKDNFTAAGYCYLESVARMTVQDVLSLGITSLEHQKLILAAIQTLRAQVIQM
HGRGVQV
Download sequence
Identical sequences I3K7K0
ENSONIP00000017095 XP_013128044.1.78416 ENSONIP00000017095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]