SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017435 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017435
Domain Number 1 Region: 257-450
Classification Level Classification E-value
Superfamily Nudix 6.63e-43
Family NADH pyrophosphatase 0.0017
Further Details:      
 
Domain Number 2 Region: 11-100
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-19
Family Ankyrin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017435   Gene: ENSONIG00000013868   Transcript: ENSONIT00000017450
Sequence length 456
Comment pep:known_by_projection scaffold:Orenil1.0:GL831164.1:1110400:1116048:1 gene:ENSONIG00000013868 transcript:ENSONIT00000017450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSYQLSAKEDMVEKFLDAAARGDMSQVSILLSHVPSLINQTGYSGWTALMLAARNGHSH
VVEKLLSHGCDKFIVNSSSQTAYDVAKFWGHKHIANLLCQTDDGCRRVLQGSDISPQENY
FSRETLDRLSGKRTDKAWLEAKQREPDTVYLIFSNLSPMVSTSQEDDGAAVESKLCRFRY
EAVKDLLQKPATVLIFLGVEKRKNPSPSSPEEGIREAPAWFAFSTDEDAADLVKRCREKN
CSFPKMPNRDLLKLNEEEAGIVAQARSVLAWHGRYSFCPTCGSSTKLEDGGHKRSCLNSE
CRSLKGVHNTCYPRVDPVVIMLVIHPDGNQCLLGRKKVFPAGMFSCLAGFVEPGETIEDA
VRREVEEESGVKVGPVQYVSCQPWPMPSNLMFGCLAVAISTDIKVDENEIEEAQWFTRQQ
VIDSLFRGASPAFNIPPRQTIAHQLIRHWIGINANL
Download sequence
Identical sequences I3K8J0
ENSONIP00000017435 XP_005451523.1.78416 ENSONIP00000017435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]