SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017566 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017566
Domain Number 1 Region: 582-645,912-1032
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-41
Family Ypt/Rab-GAP domain of gyp1p 0.0079
Further Details:      
 
Domain Number 2 Region: 4-195
Classification Level Classification E-value
Superfamily RUN domain-like 9.55e-33
Family RUN domain 0.00061
Further Details:      
 
Domain Number 3 Region: 1008-1130
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-26
Family Ypt/Rab-GAP domain of gyp1p 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017566   Gene: ENSONIG00000013976   Transcript: ENSONIT00000017581
Sequence length 1138
Comment pep:known_by_projection scaffold:Orenil1.0:GL831275.1:1195761:1209327:-1 gene:ENSONIG00000013976 transcript:ENSONIT00000017581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEAETRQKLLRNVKKEVKQIMEEAVTRKFVHADSSHIISFCAVVEACVLHGLKRRIAGL
LCSNKVAALFMKVAKSFSPAAELCHKVQELEQLIENSKQNNSSLSTDRSRQSKLANLPPQ
ALKHLWIRTALMEKLLDKIVLYLVENSSSFYDKEAMLMDPVDGPILASLLVGPCALEYTK
VKTADHFWTDPSADELVQRHRIHSGHCRQDSPSRRPALIQKRQSSGSMDDRPLMWVREYV
ESLHQNSRATLLFGKNNVLVQPRDDMEAIPGYLSLHQTADLMTLKWTPNQLMNGNVGELD
SEKSVYWDYAMTIRLEEIVYLHCHQQVNSGGTVVLVSQDGIQRPPLHFPKGGHLLQFLTC
LETGLLPHGQLDPPLWNQRGKGKVFPKLRKRSPHGSCDSVSDKEDDEATDYVFRILFPGN
QMEFKSSKIISVTALITLYMTLMFPPDIHSVFVFVISKSVRAAPGFACLIDCDNRNSSMA
PELMDQGVNMWQPAPRKSSCSSCSQNGLSDGSLPNGCNQERAPLKLLCDTMKYQIISRAF
YGWLAYCRHLSTVRTHLSALVNTTIVDPGVPCDARGGLSVEVWSNFLKDSSAYEEKEIHR
LVYFGGVAPSLRKEVWPFLLGHYKFGMSEKCRREIDEQMRCMYEQTMKEWQGCEAIVRQR
EREKHAEALARCSSGVSVERGPVQRDSTISTDSSLSSNSDQQNTHSQSDSSSSAQVFESV
DTADQAESESRAEEAQHRDAGKAIGNATTDSDNRHPVTESVSQQTAENSEACSEEPTAGS
QPVKIQLTTCESGEEDVKDPAAESEADAQKRETVSESIVVQETKEKSEAEQKAEVEEKDQ
TKHGLSGASKATDTDINLKENTNVLKLETEIHNEYFQAPPLEEEPEIENVLTEPESAEVG
GVTKYDESSEEQTYSQETMDMYLINLHRIDKDVRRCDRTYWYFTTENLEKLRNIMCSYVW
QHLDIGYVQGMCDLLAPLLVILDDEIMAFSCFTELMKRMNQNFPHGGAMDSHFANMRSLI
QILDSELFELMQQNGDYTHFYFCYRWFLLDFKREMVYDDVFSVWETIWAAKHTSSEHFVL
FIALALVEMYRDIILENNMDFTDIIKFFNEMAERHNVPQVLMMARDLVHKVQTLIENK
Download sequence
Identical sequences I3K8X1
ENSONIP00000017566 ENSONIP00000017566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]