SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017678 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017678
Domain Number 1 Region: 1484-1545
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000197
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 2 Region: 1026-1204
Classification Level Classification E-value
Superfamily RUN domain-like 0.00000000288
Family RUN domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017678   Gene: ENSONIG00000014064   Transcript: ENSONIT00000017693
Sequence length 1557
Comment pep:known_by_projection scaffold:Orenil1.0:GL831164.1:3389231:3409028:-1 gene:ENSONIG00000014064 transcript:ENSONIT00000017693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IILVELQAMDSPPKLSGETLIVHHIPLVHCQVSGRRQGGCGSSMKRTNPFSPPENLGLSR
TTSLPERDVLQREALLYSSLIQTSSGSWSSHNGGRERKGGGRGGRNPLRHNPFLLNTEED
EDDEGEEDDGDNLSGYLEDSSFHLHSDTHSALDDGLTSFHLHDLGFASQPFLLHSSVGGS
SGESLRGGASDLSNHLEDLDMLELTSQRRHGSSGSNMSMDCGDQDWGDDDEEDEDHPMSS
STQHCSCCTLSQNYPRHFPEAFSEPFLECQQGYGSDSSCNSSDGVLVNFSAIYNKMNNSV
PEKPPVSGPTNLNSSIDHSCTSSASDLPGNRDSTGGAFYLDLHTSPTEPPLSHQLGNTFP
LIREPRLSSSSTCSCSVEHQGALDLDANCNSYHPPHAGSSGDLASCLQSQARLVVATQNY
YKLVTCDLSSQSSPSPAGSSVHSCSDEHSKDSPTPTQPSEYFLFRQQAHEEGVEEEDEEG
ETSRGASGAKTGPAVIEGQVYVNISPPMSGRGVIGASAGSRPRSRSYDRNLDKSPSPRLG
SLERMLSCPVRLSEGAAVTPPPPPRVTSFAEIARSKRRNGGAGGSPSVKAASDAVSSHSH
SSVDFSPILEQRVEADSQALSPVPFTRCYREFPNYISASSTLAFICSPSVYLMNGSQIHC
FLLANLGSANSGATNSFFDASLGFRQQPRTCHLTRFTEYRCGLSSSADSRSAVVRYSKDQ
RPTTLPIQPFTFHHQFAAKAPQPKPLAPLLTGYISSMQARSSLGSGSGSGGPVGEDSDDA
AEKVHSFQGSLITTAPPPGLVRPSPLGSYSPVRLQGAPSSGTCSTCTPSPKPTHSLSCPL
SAGLGPLQTPSTIKQAGASAPLPTTPPPSSLGLKRGAVPPMLPAVQGHSHQQTLIRPLYR
NPNTSPPTTAHHLSPQALKWREYRRRNPLGVERVSGCHASAGLGPRPARRNVFDFPSVPS
GHKLGRLNAVGQSAKLQQSYSDFLSDYFSLTEKPPEEFCLSPDASTSSSLCSSSQSHISV
DLTQKRALVKAVNTAVDLIVAHFGTSRDPDVKAKLGNSWVSPNVGHLILKYLCPALRDVL
QDGLKAYVLDLIIGQRRCQPWSLVEASTQLGPSTRVLHSLFSKVSQYSELTSHSMRLNAF
IFGLLNLKSLEFWFNHLYTHEDIIAAYYSPWGFLPLSQGPCQPLFEELLLLLQPLSLLPF
DLDLLFEPHLLQKGQEQLRRKEQLCSAGQSVDQSKCSTFQLMRGWSNTVSEMERGVEGQR
VKGVGQESHGECEDTKEKDKRKEKDRFPADEGRQRQDRQAGWWYQLMQSSQVYIDQSTEG
TKFVKTEKRKKSSERRQGQIPPTREGVVEGAEATQEGEGGKSSSSSSLSGDSSGSRGRPS
WMGSPPESVLNQENHTNPLEVTGTGSHDGAQDESPSQGQSLRWSRLFGSSVGSPSKAEGG
EQRPKTQKTRPPSGWLGLDRSVLDFVALTIGAGPGKKAELPATPTRTQSEVRALCHHIAT
EPGQLSFNKGDILRVLSKADPDWLLCSLGSTQGLVPIVYVTLNSMEDSQDAPGFGQC
Download sequence
Identical sequences I3K983
ENSONIP00000017678 ENSONIP00000017678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]