SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017866 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017866
Domain Number 1 Region: 807-1002
Classification Level Classification E-value
Superfamily Sec7 domain 5.49e-76
Family Sec7 domain 0.00000188
Further Details:      
 
Domain Number 2 Region: 564-747,1256-1271,1302-1649
Classification Level Classification E-value
Superfamily ARM repeat 1.68e-28
Family PHAT domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017866   Gene: ENSONIG00000014215   Transcript: ENSONIT00000017881
Sequence length 1989
Comment pep:known_by_projection scaffold:Orenil1.0:GL831157.1:962910:1012690:-1 gene:ENSONIG00000014215 transcript:ENSONIT00000017881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVQRKLGCRATFISVLTPYCLTAAVLKRALRLTLLKELHLCSRRLQPPLGPGTPRSKFR
CDMFEGKKTKNMFLTRALEKILADKEVKKAHHSQLRKACEVALEEIKEESEKLSPPGGDG
KSGSSTLPPIKSKTNFIEADKYFLPFELACQSKCPRIVITSLDCLQKLIAYGHLTGSAPD
STAPGKKLIDRIIETICACFQGPQTDEGVQLQIIKALLTAVTSQHIEIHEGTVLQAVRTC
YNIYLASKNLINQTTAKATLTQMLNVIFARMENQALQEAKQLERERHRQHSPVTQHTEPD
SAQHQTHIHSPAKGPTREANGPLTPPTPSITTPSTPSTPSTPAPESSGRSAPKEQEEQRE
QEEKGENPDPENGSEFCVAESEQTEADQATAAAESAAAQKHAEAAEDEDRETPNYEEKAQ
EIVQSILQEVVNTVAGGHCLDPANLCSDTKESGGEGEPAESEPAEAATEGTQSSLEDEGT
VGSDSEHVHANGIPGTPISASFTPSLPDDRLSVSSNDTQESGAAPGQPPGAKFSHILQKD
AFLVFRSLCKLSMKPLSDGPPDPKSHELRSKVLSLQLLLSILQNAGPIFKTNEMFINAIK
QYLCVALSKNGVSSVPEVFELSLSIFLTLLSHFKTHLKMQIEVFFKEIFLYILETSTSSY
DHKWMVIQTLTRICADAQSVVDIYVNYDCDLNAANIFERLVNDLSKIAQGRGGHELGITP
QQELTLRKKGLECLVSILKCMVEWSKDQYVNPNSQTSLGQEKPSEQESTESKAPETINRY
GSINSLDSTASSGIGSYSTQMSGTDNPEQFEVLKQQKEIIEQGIDLFNKKPKRGIQYLQE
QGMLGTTPEDLAQFLHQEERLDSTQVGEFLGDNDRFNKEVMYAYVDQMDFQGKDFVSALR
MFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQ
VKNKMTKEQYIKMNRGINDSKDLPEEYLSAIYDEIAGKKIAMKETKELTMKSNKQSVASE
KQRRLLYNLEMEQMAKTAKALMEAVSHVQAPFTSATHLEHVRPMFKLAWTPFLAAFSVGL
QDCDDTEVASLCLEGIRCAIRIACIFSIQLERDAYVQALARFTLLTATSGIAEMKQKNID
TIKTLITVAHTDGNYLGNSWLEILKCISQLELAQLIGTGVKARYISGTVRGKEGFIASTK
EQSSDEYLGLVGGTVDRKQIASIQESIGETSSQSVVVAVDRIFTGSTRLDGNAIVDFVRW
LCAVSMDELASPTHPRMFSLQKIVEISYYNMGRIRLQWSRIWEVIGDHFNKVGCNPNEDV
AIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKKNRSPTIRDMVVRCIAQMVNS
QAANIRSGWKNIFSVFHLAASDQDESIVELAFQTTGHIVTNVFEKHFAATIDSFQDAVKC
LSEFACNASFPDTSMEAIRLIRHCAKYVSDRPQAFKDYTSDDMNVAPEDRVWVRGWFPIL
FELSCIINRCKLDVRTRGLTVMFEVMKTYGHTFEKHWWQDLFRIVFRIFDNMKLPEQQTE
KAEWMTTTCNHALYAICDVFTQYFESLNGVLLDDILAQLYWCVQQDNEQLARSGTNCLEN
VVILNGEKFSPETWDKTCNCMLDIFKTTIPHALLTWRPAGAEGEHLSTQSLPDKQLDSVS
QKSLDIQSRSDDQHSISSSDRAAMENRRQSQYSSASGVTEDGPRSRTQTKIQEQRLFSAL
LIKCVVQLELIQTIDNIVFFPATSKKEDAENFAAAQRDAVCSADVSVETQDQGMYRYLTS
EQLFKLLDCLLDSHHFAKAFNSNNEQRTLLWKAGFKGKSKPNLLKQETSSLACGLRILFR
MYTDESRRDAWEEVQRRLLNVCSEAVAYFLALTSESHREAWTNLLLLFLTKVLKISDERF
KAHASRYYPLLCEIMQFDLIPELRAILRKFYLRIGIVFNIAQLPEPEPQQAREPETDMEV
GEEAGEEAQ
Download sequence
Identical sequences I3K9S1
ENSONIP00000017866 ENSONIP00000017866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]