SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017947 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017947
Domain Number 1 Region: 4-360
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.53e-84
Family Regulator of chromosome condensation RCC1 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017947   Gene: ENSONIG00000014277   Transcript: ENSONIT00000017962
Sequence length 1622
Comment pep:known_by_projection scaffold:Orenil1.0:GL831258.1:883119:894992:1 gene:ENSONIG00000014277 transcript:ENSONIT00000017962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPETGAIFTFGRTSFANNVPSKFWLKNDHPKHMSCGGEHSAVITENGRLLMFGGNTWGQL
GLRIKPSARKPTSVKALKSEKVKLAACGRDHTIVCTFHGSVYSAGSNQDGQLGLGHCDKS
TYFHLLRPFCDWAPIKMLSAGCNTSAALTEDGRLFMWGDNSVGQIAFGDEGFAAEPREVH
VGEAVIWVSCGYKHSAFVTVYGRLYTFGESANGRLGLQKEQLANHRVPQQVQGVLGHVTR
VCCGGEHTVVLTEKNVYTFGRGQYGQLGHGTFLFEVHLPKALQHFCNSKVRHIACGENHT
AVVTDSGLLYTFGDGRHGKLGLGEENFINQFSPTLCTRFLQYAVQSVSCGGHHMLVLATP
RPAESQEVVPEKDVLITDDFLESSFTKIIFKNKFINPTPPSPLSALSARARHRDRVRSVE
LFGDKFQSLPRLNSDFLNTSRQTSRNSLTLKTLSKDATTPSSSPKPKSEVAGSPLLSPRS
RSISPQSPLISSKASSPHSQSSFTLQSKASTSASSKSKSKSITKLNPSSPVATKMTAKPR
LNRAAAPKKPLSNKFSSPVPPKEPYTPTRPPSNVFIKNLKEEEHPAPTQTGNFPLGKTMK
QNIKEKKKGRAFRHGVKEAEAFAQQIQTNEKTDRNSHKVLPTELMKGPSTLKTEVSHLKS
TKKNHKVTSNSKENITKESSDIKPSENRQAQKQLPHFKSPQQDKRKPSEYSTKTQQTLTD
APGRVTEVKHKTRKTEDLRESNKPNEEDNSSLKKGLTRTPRKETKKSVSLDQKSPSIKVS
KVNQAANLASTENAVKENEATQRGSDDVKPVEVASRGTRRVKSTLTKDQHKVKSVPGKGI
KVNVQKIPSLKVKAKKSVRKMSLLSSQQDTPTEVRGNPISPQSPEVDSLRAAKPLQGAEP
VGMDSRVSETDEEDTRGKNGEKTNWGEILSNSASLLPAAGIAGAAIEVLRQAVTSVQSDS
DKATSTPSKTLSNESVNESQEGENDDSSRDPSEGEAVKGGLSEQIRGEHMEDSQKEVEEK
SEKESGEDEDSEDGGKNEDEDVESGSDSEDKREESESSSDKETGEESNTGEGEEDNVSEE
EEGEEKTSRSDEDEGSDKTNAAETEGEEESSKKTSDGLSDSDVSEGAEEEEEEGENEESS
DEESKEDKEEESKMSEDEEKKSGDESESDESTSRESEEGEEDGEEGDTAESAKTEEEEND
EDEEGETEEHNDASTENEDEEKDSVEDEEADKSEGEQDSDKGEEEGDSGADEEELQDEKS
DEEEEEGGEEREERESVGDGEAETEAGEDEDKEESEEEEESAEEEEKEEEDTGDEDTEAE
EEEEEKEEDAGDEDTKAEEEEEEKEEDTGDEETEAEEEEEEKEEEKAEEEEEEKEEDTGD
EETEAEEEEEEKEEDTGDEETEAEEEEEEKEEDTEDEDIEAEEEEEEKEDIGDEEKEAEE
DVTEEEDEEENESEEEEKPKGKNKSMEPAKKNLLESDEGEGEEEEGEGEGEEEGEEEEEQ
QKQTRLRGERKDMKEEENKERGNENQEEEEAEEEGIEEEEEGDENEEEEGEDEEEEEEEE
EQAKSAKKIKEKRQKPPPDRSDKQKEAPKPAPRTRQRAAGEAKAEESQQFWNDVLPQYLD
LQ
Download sequence
Identical sequences I3KA02
ENSONIP00000017947 ENSONIP00000017947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]