SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017970 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017970
Domain Number 1 Region: 50-91
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000575
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 2 Region: 11-53
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000405
Family Somatomedin B domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017970   Gene: ENSONIG00000014294   Transcript: ENSONIT00000017985
Sequence length 240
Comment pep:known_by_projection scaffold:Orenil1.0:GL831157.1:1736691:1740963:-1 gene:ENSONIG00000014294 transcript:ENSONIT00000017985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGKCCRGRDTNCLTTDWRMDRVHGTCYCDEGCVRTKDCCFDYFTECPAQDCVVSDWSFWS
GCAKPCQPSVRIRVRHIEQQPHNSGQPCPGLEQRAGCREYRDHQGRHCGFNSGPAFITSM
AFAKGRPKHDRKSAYTKGWDDSRFCVEFKLESRTPHCTVENRPHTLWMRYITEGFNVCVA
CEPPAMRNNTSSCQGDGQESDKETVLHWQAVGNPRCSGTWKKIQKTQQCACPPQHSFVFI
Download sequence
Identical sequences I3KA25
ENSONIP00000017970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]