SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018620 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018620
Domain Number 1 Region: 379-393,430-635
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 3.6e-38
Family Cofactor-dependent phosphoglycerate mutase 0.02
Further Details:      
 
Domain Number 2 Region: 23-77
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000351
Family UBA domain 0.00089
Further Details:      
 
Domain Number 3 Region: 245-310
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000761
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 4 Region: 82-210
Classification Level Classification E-value
Superfamily LigT-like 0.00000645
Family Atu0111-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018620   Gene: ENSONIG00000014789   Transcript: ENSONIT00000018637
Sequence length 643
Comment pep:known_by_projection scaffold:Orenil1.0:GL831386.1:858577:900378:-1 gene:ENSONIG00000014789 transcript:ENSONIT00000018637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAKEDLYSKILPRRLRQNRAGSMKCSSSLDVLLSMGFPRPRALKALVSTGGRSVQAACD
WLFSHVDDPFLDDPLPREYVLYLRPSGPLQNQLSHFWQQSRVTCGKNKAHNIFPHITLCQ
FFMCADQKVEALCEALQATVQQWRGRFPSPLPLELYTSSNFIGLFVEEQVADILKQFAAD
FAAEAVRKAEVHVEPHKKQLHVTLAYNFPSDHLPSLEKLAKGIEVKLGCDWLAVLFSRDI
RFANHETLRVMYPYMPQNDDELELVPGDFVFMSPVDQNSTSEGWVYGTSLATGLSGLLPE
NYVSLADESDTWVFHASHSFFSCEPSDKASKDRGLFDGLLDSRRPDSTSPGDTPSLSLIC
HPMQQVLRISGGHSRQPKRTLFVCRHGERMDVVFGKHWLSLCSDSKGRYVRSNLNMPPSL
PLWGGQRDYDMDAPITVFGSTQARLVGEALLESNTAIDFVYCSPALRCVQTAQNILKGLQ
QDSKLKVRVEPGLFEWTKWVSGSSMPAWIPPTDLAAAHFSVDTTYRPLIPVSKLTVSESY
ENYMSRSYQVTKDILSDCKNTGNNVLIVAHASSLEACTRQLQGRSPQSAKDFIQVVRKIP
YLGFCSCEEQGDTGVWQLVDPPILPLTHGPNHSFDWRETLLQE
Download sequence
Identical sequences I3KBX5
ENSONIP00000018620 XP_013121081.1.78416 ENSONIP00000018620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]