SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018738 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018738
Domain Number 1 Region: 22-118
Classification Level Classification E-value
Superfamily Hormone receptor domain 7.85e-24
Family Hormone receptor domain 0.00026
Further Details:      
 
Domain Number 2 Region: 122-409
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000229
Family Rhodopsin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018738   Gene: ENSONIG00000014886   Transcript: ENSONIT00000018755
Sequence length 440
Comment pep:known_by_projection scaffold:Orenil1.0:GL831188.1:55975:124396:-1 gene:ENSONIG00000014886 transcript:ENSONIT00000018755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLLFVTLCLSTCPLTVDGRHPTCNFLLEVERDQAECIKKLREKEANSSYKGPGCKGDW
DSIACWERAGFGETVTIPCPRVLRTVFGREGNISRNCTTAGWSDVFPNITSVCGADTSQD
KLVFYLVVQTLYTLGHSLSLIALTTGCAILCLFRKLHCTRNYIHLNLFFSFILRAVAVLV
KDDILFNRNSHCSNQPSLVGCKASLVFFQYFIMANFFWLLVEGLYLHTLLVVIFSENRHF
IVYMFIGWGIPTVFVSAWVITRIYLEDTGCWETNDNPIPNWVINGPIGFSIMVNFIQFIC
IIRILVQKLRCPDVGGNDQSQYRRLAKSTLLLIPLFGIHYVVFVTLSESIAEDYKIFFDL
ALGSFQGLVVAILYCFLNSEVQGELKRKWRSMCLNCRLSRSRHNNTSRNGSQHMVQFHSN
SRTQSILQTETSVLREHEGL
Download sequence
Identical sequences I3KC93
XP_003447490.1.78416 XP_019203985.1.78416 ENSONIP00000018738 ENSONIP00000018738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]