SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018739 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018739
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily Hormone receptor domain 4.84e-18
Family Hormone receptor domain 0.00055
Further Details:      
 
Domain Number 2 Region: 94-382
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000467
Family Rhodopsin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018739   Gene: ENSONIG00000014886   Transcript: ENSONIT00000018756
Sequence length 413
Comment pep:known_by_projection scaffold:Orenil1.0:GL831188.1:55975:87399:-1 gene:ENSONIG00000014886 transcript:ENSONIT00000018756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGPGCKGDWDSIACWERAGFGETVTIPCPRVLRTVFGREGEYVFQSKAVSWSATHHRELK
PEYSNISRNCTTAGWSDVFPNITSVCGADTSQDKLVFYLVVQTLYTLGHSLSLIALTTGC
AILCLFRKLHCTRNYIHLNLFFSFILRAVAVLVKDDILFNRNSHCSNQPSLVGCKASLVF
FQYFIMANFFWLLVEGLYLHTLLVVIFSENRHFIVYMFIGWGIPTVFVSAWVITRIYLED
TGCWETNDNPIPNWVINGPIGFSIMVNFIQFICIIRILVQKLRCPDVGGNDQSQYRRLAK
STLLLIPLFGIHYVVFVTLSESIAEDYKIFFDLALGSFQGLVVAILYCFLNSEVQGELKR
KWRSMCLNCRLSRSRHNNTSRNGSQHMVQFHSNSRTQSILQTETSVLREHEGL
Download sequence
Identical sequences I3KC94
ENSONIP00000018739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]