SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018748 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018748
Domain Number 1 Region: 267-352
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000517
Family I set domains 0.017
Further Details:      
 
Domain Number 2 Region: 30-116
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000158
Family V set domains (antibody variable domain-like) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018748   Gene: ENSONIG00000014894   Transcript: ENSONIT00000018765
Sequence length 403
Comment pep:known_by_projection scaffold:Orenil1.0:GL831175.1:3941367:3950983:-1 gene:ENSONIG00000014894 transcript:ENSONIT00000018765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AWSYEAPEDKQDVFARTACPAFLTFTNAAYLSGVTVELPCLCKPEQVQSVVWFFRKHLER
SEDTKALTDHHGNHLLDPSQVPHSGDLRSRFSIRLFSLLIFRAGPDDAGVYICGSAHKDF
FYGYDLDIQEAATLSFTNRLASEAGDGKRDQSTDLSALYHLFTSFQPWSVCDRCGVPGEQ
VRAGLCYIRSRFLNVRYRRANQTIVSCGSGAVPRAFGLKRSRVAVKLEVRSCHMTCPSQA
PPSKLLGLMSLFGSSSASLPTGLPLYYLTHPDGQVLTLGCPGARPDMAVAWDRGDEPIYR
SEHSSGAGTGLRLIIDTGHHLLFQPAQTQDSGVYYCWLYGHRAAEIHLLVYPHFGSQSLL
SHPDFPAAVRIVLGSYAAMTAVFFLLMLGRAVLRHRREQSHVD
Download sequence
Identical sequences I3KCA3
ENSONIP00000018748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]