SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000020351 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000020351
Domain Number 1 Region: 374-546
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.52e-51
Family SPRY domain 0.00047
Further Details:      
 
Domain Number 2 Region: 137-200
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000534
Family B-box zinc-binding domain 0.0007
Further Details:      
 
Domain Number 3 Region: 8-66
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000408
Family RING finger domain, C3HC4 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000020351   Gene: ENSONIG00000016158   Transcript: ENSONIT00000020369
Sequence length 555
Comment pep:novel scaffold:Orenil1.0:GL831216.1:126080:129395:-1 gene:ENSONIG00000016158 transcript:ENSONIT00000020369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSGFPLPPEAFCPLCADTVRDPVTIPCGDTYCLECIKIYWDQFDHMGVYSCPQCRATF
TPRPVLKRNLPDVYHEPRRELPELTPFPYLNREVYCDFCVGRRNKAVKSCLMCLAYYCET
HVKPHYESSTFKRHKLVDEMGHLDRKICPQHEKGLELFCRTDQMCICVLCTVREHRSHNI
TSAEDERIEKQKVLVVTQTEVQRIIQERMKELQELKHNIDVLKSEAQRAQAESDKTFHEM
LQAVERWKSEINQMIMANMQSAMSQAEGYVDRLEQEIMELQRRDAELQQILETEDNIHFL
QIKQSFPTLCVAPEAMVPKVLINPQFSFGEMSKTASDMKENLDDICKKEMGKLSKTVSET
PVYILLPRNEPKNRTDFLRYACKLSFDPNTVYKELVLTDGNQKVARKKTIQFYPDHPERF
DGFSQVLCKEPLTGFRFYWEAEWSGEFSIGVAYRSISRKGKNSHSLLGYNDKSWSLLCSD
SGYSAWHNKVDRDLPGAPRATRIGVYLDYAGNTVAFYSVSDTMTPIHRFKAQFTEPLYAG
FGVGSSVTLCQLKQP
Download sequence
Identical sequences I3KGV6
ENSONIP00000020351 ENSONIP00000020351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]