SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000020516 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000020516
Domain Number 1 Region: 365-563
Classification Level Classification E-value
Superfamily Kelch motif 3.79e-29
Family Kelch motif 0.0013
Further Details:      
 
Domain Number 2 Region: 74-203
Classification Level Classification E-value
Superfamily POZ domain 1.61e-24
Family BTB/POZ domain 0.0057
Further Details:      
 
Domain Number 3 Region: 599-665
Classification Level Classification E-value
Superfamily Kelch motif 0.000000000536
Family Kelch motif 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000020516   Gene: ENSONIG00000016296   Transcript: ENSONIT00000020534
Sequence length 714
Comment pep:known_by_projection scaffold:Orenil1.0:GL831148.1:4312401:4317678:1 gene:ENSONIG00000016296 transcript:ENSONIT00000020534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSECLFTCVGYTCELFPKIVRSCHLPLSFTPCGMAAAAEDTEERGRSGSTGGGAVQGA
LTGDGEPEEAEEFTCSAYCSELSRRQNEQRKAGLFCDVTLIFSSGAVPGVQTVSAHRSVL
SAASQYFMLLLSGQFSESLSGRVELKEWSSGTRPDPDTVESVVQFMYTGEVRVTTANVHE
VLELADRFLLGQLKTFCGEFLMRKLSMSNCVAVHSLAHMYTLNQLAQRAAETIRRNFHKV
IHNEEFFTLPFHLVRDWLCDAEITVESEQELFEAIMKWIHHNPEEREKHFEDLFRLLRLA
QIAPTYLTRVVRKEPLVANSAACLELVSSALEVHAVRYESPKKADSDLGDSYEATIQPRY
GQNMDVIMVVGGVSEGGDYLSECVGYFVAEDRWVSLPHIHNHLDGHAIAVTENHLYVAGS
MEPSFAKTVERYNPNLNCWESVSSLTTRKHSFGLTCVRDTLYIIGGHGNFSPGFKDVSIY
EPEQDMWLNLEPAPKILRDVKTVSVEDRYVYVMARTPVDIDSDDGLSTVTTCYDTESCKW
QEVDSLPLIDTYCSFQMAVASSNFYHTASCCPKNYTVTHEAAQQKISRNISEDILDSLPS
EVLSLEGAAICYLGEDIFIIGGWKNSNHVEKQYRKEAYRYCAKRKRWMLLPPLPQPRCRA
AACHVRIPYQYLYGSQRYPVPHNLARQRDRMQQMQQLHRRTLSLRRQMQSQIEC
Download sequence
Identical sequences I3KHC1
ENSONIP00000020516 ENSONIP00000020516 XP_003441890.2.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]