SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000020758 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000020758
Domain Number 1 Region: 380-556
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.66e-46
Family SPRY domain 0.0011
Further Details:      
 
Domain Number 2 Region: 10-80
Classification Level Classification E-value
Superfamily RING/U-box 5.52e-20
Family RING finger domain, C3HC4 0.0066
Further Details:      
 
Domain Number 3 Region: 142-204
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 9.01e-17
Family B-box zinc-binding domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000020758   Gene: ENSONIG00000016482   Transcript: ENSONIT00000020776
Sequence length 561
Comment pep:novel scaffold:Orenil1.0:GL831471.1:298971:335820:-1 gene:ENSONIG00000016482 transcript:ENSONIT00000020776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSATSNLQSEDQFLCSICLDVFTDPVSTPCGHNFCKTCISQHWDLNVMCQCPMCKETFNI
RPQLRVNTFISEMVAQFRREAQQKASSSSSEQQAAKPGEVPCDFCTGTRLKALKSCLVCQ
TSYCQTHLEPHLIKEGLKRHQLIDAVVNLEGRMCTKHDKHLELFCKTDQTCVCTLCPILD
HKNHEFVPLREEYEGKKAELEKTEAGIQQMIQKRRLKIQEVKESVKMSKDAADRQKAEGV
QVFTALMESVERCLKKFIKEIEDKQETTEKQAEGLIKDLEQEISELMKRSSEVEQLSRSE
DHLHLLQSFSSLKTVPPTKDWTEVRVRLPSYEGTVVRAVDQLEETLWKPMKKWGDWTELQ
CLFREIDEVINKETACPETVLTYYSCQLTIDTNTVHTKLQLSDNNRKVTHVEEVQSYPDH
PDRFDGRAQLLCENGLTGRCYWEVEWRGDVYISVSYRSIRRKGGGAFGGNEQSWSLNCTD
NGPVRVRHNNRVTYIPSSSSSSSSCVSNRVAVYVDCPAGTLSFYRVSSDTLIHLHTFNTT
FNEPLYPGFSFRSRGSSVSLC
Download sequence
Identical sequences I3KI13
ENSONIP00000020758 ENSONIP00000020758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]