SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000020962 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000020962
Domain Number 1 Region: 311-521,561-610
Classification Level Classification E-value
Superfamily Kelch motif 6.93e-44
Family Kelch motif 0.00091
Further Details:      
 
Domain Number 2 Region: 47-158
Classification Level Classification E-value
Superfamily POZ domain 4.19e-34
Family BTB/POZ domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000020962   Gene: ENSONIG00000016640   Transcript: ENSONIT00000020981
Sequence length 652
Comment pep:known_by_projection scaffold:Orenil1.0:GL831207.1:386361:395419:1 gene:ENSONIG00000016640 transcript:ENSONIT00000020981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAVRGGTVTWRPQPWQDGDGGGGEPLSDSDSEEEDFPDDSTTPLGDYITHGLKQLLDAQ
QLCDVTLLVEGKKFMCHRVLLAAVSPYFRAMFTSPLVESRLTEIRLEEVTPSVMETIIQF
VYTGEAGLSLDTAEDLFVAANRLQVMPLQDLCSRFLFEHLSVDNCLGMYSLARSHHDQLL
LRASLRLVAQHFPRVARQKDFLLLDHGTLGSLLSSDRLGVDSEAEVYDAARRWAEHQPLD
RYAHMPALLHHLRPGLLSQEESRRLSQELGPAAAGEGLGGPLRPREGMFEKKIVCVDLTP
REDEYLAARDYTVDCFDPRTGKWEKLAPLGSLVSPGCTAVGDRLFVAGGILRTGSVSAAV
HEYDAVLDRWIEQPSMVQPRAMLGLLGCGESLYALGGSNRSALLDSSETLDLTTLQWSPG
PRLPLPLRAFACAALRGRLYLLGGTTLEQNRAVVHSGVFIYHTLTDCWTRVALDSGATCL
AGGVAVRGGVCAIGGYMRDTTKFLDGNYTNLETLDATGRVLFFREGRGSGVEREVTGGGV
LVSAEQRGGAGGGSDRAPSPVVFPGLPRRIAAGGVARWKRRIYVLGGENGSRFYDSVYCW
KPGWRSWVQRREKLPGDTGGVSQFGCTTLKFPKKHILSRLRLAKENCKKPSD
Download sequence
Identical sequences I3KIL7
XP_003449320.1.78416 ENSONIP00000020962 ENSONIP00000020962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]