SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000020969 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000020969
Domain Number 1 Region: 10-481
Classification Level Classification E-value
Superfamily Sema domain 3.53e-129
Family Sema domain 0.0000275
Further Details:      
 
Domain Number 2 Region: 1327-1456,1652-1841
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.28e-51
Family p120GAP domain-like 0.029
Further Details:      
 
Domain Number 3 Region: 928-1017
Classification Level Classification E-value
Superfamily E set domains 2.59e-18
Family Other IPT/TIG domains 0.025
Further Details:      
 
Domain Number 4 Region: 832-928
Classification Level Classification E-value
Superfamily E set domains 0.000000000000035
Family Other IPT/TIG domains 0.011
Further Details:      
 
Domain Number 5 Region: 1015-1119
Classification Level Classification E-value
Superfamily E set domains 0.000000000000336
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.065
Further Details:      
 
Domain Number 6 Region: 484-535
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000235
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 7 Region: 781-815
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000288
Family Plexin repeat 0.0033
Further Details:      
 
Domain Number 8 Region: 1120-1197
Classification Level Classification E-value
Superfamily E set domains 0.00000638
Family E-set domains of sugar-utilizing enzymes 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000020969   Gene: ENSONIG00000016645   Transcript: ENSONIT00000020988
Sequence length 1871
Comment pep:known_by_projection scaffold:Orenil1.0:GL831137.1:1749757:1881006:-1 gene:ENSONIG00000016645 transcript:ENSONIT00000020988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PALSNGQTFTSFHPERRDWVFNHLTVHQTTGALYIGAVNRVYKLSGNLTLLVSHDTGPED
DNKACYPPLIVQPCSEPLVSTNNVNKLLLIDYSQNRLLACGSLYQGVCKLLRLDDLFILV
EPSHKKEHYLSSVNQTGTMYGVIVPSQGQDGTLFIGTAVDGKQDYFPTISSRKLPRDPES
SAMLDYELHTDFVSSLIKIPSDTLALVSHFDIYYVYGFASGSFVYFLTVQPETPENSMSS
SGSGSDLFYTSRIVRLCKDDPKFHSYVSLPIGCVKSGVEYRLLQAAYLGKPGRVLAASLN
ISAHDDVLFTIFSKGQKQFHRPPDDSALCVFTIRDINARIKERLQSCYQGEGNLELNWLL
GKDVQCTKAPVPIDDSFCGLDINQPLGGSQLVTGHTLYTETRDRMTSVTSYVYNGYCVAF
VGTKSGRLKKIRVDGPPHGGVQYETISVIKDGSPVLRDMAFSLDRNYLYVMSERQVTQVP
IESCEQYGTCGECLSSGDPHCGWCVLHNICSQRNRCERADEPYRFAASLNQCVKATVYPD
SIAVSEPSVHLLVKVSDVPDLSAGITCSFGNLTEVEGQVNGNQILCKSPAAKDVPLIPTD
QANPPCVELRLNSKETGQMLISTEVKFYNCSVHQLCLSCVNSAFRCHWCKYRNLCTHDPS
SCSFQEGRVNASEDCPQLVRSEEILIPAGEVKPITLKAKNLPQPQSGQRGYECVLHIQGV
SHRVTALRFNSSSVQCQNSSYLYEGMKISELPVDFSVVWNGNFIIDNPENIKVHLYKCAA
QRDSCGMCLKAERKFQCGWCSGEGRCTLRHHCPPINPYTTRWLNLSSKNVKCTNPRITEV
TPVAGPPEGGTRVTIHGTNLGLAFSDMVGNVEVAGVRCTPVEDGYIIAEQIVCEMDMAHA
DSMPGPVQLCVGECKPELRARSSQLYSFVTPTVTGLSPRRGPESGGTKVTIMGENLGAGS
SVNVKFGNQTCEFFGRTKTEIVCYSAPSLSGVGPVQISVSVDRAQIRESLTFEYTEDPTV
QRIEPDWSIASGHTPLMVTGTNLDVVQEPRIRVKYAGRESVNVCKVLNTTSMSCFAPSLM
AEYHPGLDTVKHADEFGFIFNNVQALLVYNNTNLLYYPNPYFEPLSTTGILEQKPGSPII
LKGRNLVPPASGGVKLNYTVLIGETPCSVTVSESQLLCEPPNLTGQYKVMVQVGGLHVSP
GAVHIMSDSLLTLPAIVSIAAGGGLLLIIVILVLIAYKRKSRENDLTLKRLQMQMDNLES
RVALECKEAFAELQTDINELTSDLDRAGIPYLDYRTYAMRVLFPGIEDHPVLRELEVSGN
GQQNVEKALKLFGQLINNKVFLLTFIRTLEMQRSFSMRDRGNVASLIMTALQGRLEYATD
VLKHLLSDLIDRNLESKNHPKLLLRRTESVAEKMLTNWFAFLLHKFLKECAGEPLFMLYC
AIKQQMEKGPIDAITGEARYSLSEDKLIRQQIEYKTLILNCVNPDNENSPEIPVKVLNCD
TITQVKEKILDAVYKNMPYSQRPRAVDMDLEWRQGRMARVVLQDEDITTKIENDWKRLNT
LMHYQVSDRCVVALVPKQTSSYNIPSSASISRTSISRYDSSFRYTGSPDSLRSRAPMITP
DLESGVKVWHLVKNHEHGDQKEGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETLFSTV
HRGSTLPLAIKYMFDFLDEQADKHGIHDTDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHK
SSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPNYKSWVERYYADINRLPA
ISDQDMNAYLAEQARLHSTEFNMLSALNEIYYYVSKYSEEITAALDQDEQARKQRLAYKV
EQLISAMSFES
Download sequence
Identical sequences I3KIM4
ENSONIP00000020969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]