SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021217 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021217
Domain Number 1 Region: 505-692
Classification Level Classification E-value
Superfamily Sec7 domain 2.35e-65
Family Sec7 domain 0.00000614
Further Details:      
 
Domain Number 2 Region: 720-844
Classification Level Classification E-value
Superfamily PH domain-like 7.39e-18
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021217   Gene: ENSONIG00000016837   Transcript: ENSONIT00000021236
Sequence length 944
Comment pep:known_by_projection scaffold:Orenil1.0:GL831137.1:3545382:3551836:1 gene:ENSONIG00000016837 transcript:ENSONIT00000021236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IWLLLCLSNKVSGLALLEISISVEGESQCPETGTHKDTSFSQTPYLRGSERYSDSSSNAP
SGSRGPSCVTASSSASLAWALRTRHQPASLALRKQEEEENKRCKALSDSYELSTDLQDKK
VEMLERKYGGSFVSRRAAKTIQTAFRQYRMNKNFERLRSSASESRMTRRIILSNMRLQYS
FDERQPQQQAQTQTNFTHSVAVGPPHSPDPDRTGDYTHLEDSFSKQVKSLADSIDDALTC
RAGRDDSQEGSKEERGRGAGGGLSMHGDSTATSYSDVTLYMDDGMPSSPLSLDRAPSSTD
TEYWGPSGGVGGREDSRDTEGGGSSNSRRSTPCTECRDYRLRGAHLPLLTIEPPSDSSVD
MSDRSDRGSLSRTLVFEQEPGVGAGSPQGTLKHSPNTGTRTTSTAAAQGQTRAPGRPIPT
HIPHQVAAHHHPLPPGGLEQPCCSDGDNDSLNSTTNSNETVNCSSGSSSQDSLREPLPPL
GKQTYQRECRHSWDSPPFNSDVVQRRQYRIGLNLFNKKPEKGIQYLIERGFVSDTPVGIA
RFILERKGLSRQMIGEFLGNRQKQFNKDVLDCVVDEMDFSGMDIDDALRKFQAQIKVQGE
AQKVERLIEAFSQRYCVCNPTLVRQFQNPDTIFILAFAIILLNTDMYSPNVKPERKMKLE
DFIKNLRGVDNGQDIPRDLLVGIYQRIQKWELRTNDDHVSQVQAVERVIVGKKPVSLSCV
LSLPHRRLVCCCQLYEVPDPNRPQRTGVHQREVFLFNDLLVVTKIFQKKKTSVTYSFRQS
FPLVEMQVHMFQNSYYPHGIRLTSAVLGGERKVLIVFMAPSQQDRTRFVSDLRESIAEVQ
EMEKYRVESELEKQKGVMRPSLLTGGVVGGGVGVKSDVVNGTLGRTSFDDNCSVGEGLKR
TALSSSLRDLSDTGKRGRRNSVGSLDSTMELSPLTPPSTPGSLS
Download sequence
Identical sequences I3KJC2
ENSONIP00000021217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]