SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021803 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021803
Domain Number 1 Region: 357-521
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.84e-46
Family SPRY domain 0.00066
Further Details:      
 
Domain Number 2 Region: 9-79
Classification Level Classification E-value
Superfamily RING/U-box 3.33e-21
Family RING finger domain, C3HC4 0.0095
Further Details:      
 
Domain Number 3 Region: 140-201
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000015
Family B-box zinc-binding domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021803   Gene: ENSONIG00000017287   Transcript: ENSONIT00000021822
Sequence length 521
Comment pep:novel scaffold:Orenil1.0:GL831235.1:1519894:1521495:-1 gene:ENSONIG00000017287 transcript:ENSONIT00000021822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQQTIQLDQEKLSCSICLDLLKDPVTIPCGHSYCMSCIKTYWDEKETHSCPQCRKTYTV
RPVLVKNSIFAELVEDVKKAGLPAASSDHAYAGPEDVACDFCSGRKLKASKSCLVCMASY
CEQHLQPHYNVAPLKKHKLVKATSKLQENICPRHDEVMKIFCRTDQQCICYLCLMDEHKD
HVTVSAAAERAEKQKDLAGNRQNIQQRIQDREKDMRVLHEEVKAINLSADKTVKESEELV
KDLINLIEKKSSEVKQKIRSKQKTEQNRVKELQEKLEQEIRELRRRDTELEQLSLTEDHL
HFLKSYSSLSHLSASTNVPTISVQPQQYFKDMMLEASHLRNKLQAALSEEPTNTCQKMTQ
EYACQITLDPKTANPYLSLSMSNRKAMLTQVEHLVSSHPKRFLPWWQVMSSDGLTGCCYW
EVKWSGKVLIAVAYNDISRTGSRIKCGFGNNEKSWALECGTGNYVFRHNSISTLISGPQS
SRIGVYLDHRAGTLSFYSVTKTMNLLHRVQTRFTQPLYPGF
Download sequence
Identical sequences I3KL08
ENSONIP00000021803 ENSONIP00000021803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]