SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021821 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021821
Domain Number 1 Region: 373-531
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.92e-26
Family SPRY domain 0.0042
Further Details:      
 
Domain Number 2 Region: 9-79
Classification Level Classification E-value
Superfamily RING/U-box 3.31e-21
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 140-199
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000014
Family B-box zinc-binding domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021821   Gene: ENSONIG00000017302   Transcript: ENSONIT00000021840
Sequence length 606
Comment pep:novel scaffold:Orenil1.0:GL831235.1:1586352:1601814:-1 gene:ENSONIG00000017302 transcript:ENSONIT00000021840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQQVIQLDQEKLSCSICLDLLKDPVTIPCGHNYCMDCIKNYWDENETHSCPQCRETFIP
RPVLVKNTMFADLVEDLKKAGLPAASSDHAFTGPGDVACDFCSGRKRKASKSCLMCMASY
CEQHLQPHYNVAPLKKHKLIEATSKLQDNICTHHDEVMKIFCHTDQQCICYRCLMDEHKD
HVTVLASAERADKQKNLEGNRHKIKYRIQNRERDVNVLKKELEAISLSADKALMESEGMF
KDLISLIEKKTSEVKQKIRSKQKTEQTRVKELQEKLEQEISELRRKDTELEQLSQTEDHI
HFLNNFSSLSHLNKYTDLPSTNGHTLQYFQGVTTAVLQARNKMKDLLSDEWTKILVAVNK
ADVLLPQEEPTTRGEFLKYSCGITVGPETKTKPFSLYGHQSYGNNPENSHVQSNEVLNGP
CYWEVKLTGIATVGVAKKYDSYSGSSDKRGLGSDYESWALKYSHGSYQFRHGNISTSLSG
PKSSTVGVYLDRRAGILSFYSITETMNLPHRVQTTFTKPLYAGFWLPDSSSNSLELSCLL
SRIPSLTANGNWMPLPEPGSVGGFFLLKVSFSFPLSPKCLLLRHHMIVGFFCLCIIVGLT
LQYKAP
Download sequence
Identical sequences I3KL26
ENSONIP00000021821 ENSONIP00000021821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]