SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021989 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021989
Domain Number 1 Region: 25-116
Classification Level Classification E-value
Superfamily Hormone receptor domain 8.24e-22
Family Hormone receptor domain 0.0005
Further Details:      
 
Domain Number 2 Region: 113-408
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 8.7e-17
Family Rhodopsin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021989   Gene: ENSONIG00000017436   Transcript: ENSONIT00000022008
Sequence length 442
Comment pep:known_by_projection scaffold:Orenil1.0:GL831334.1:568617:608536:-1 gene:ENSONIG00000017436 transcript:ENSONIT00000022008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLSTEIAVIALLLQRCPHVEAVRPECDPNYILLQDEVSCLELLNKTSISQGQQQECRGW
WDHVNCWPHAAVGDVVSQPCPGFLHTTGQVFRNCTELGWTDPYPPHDIACEYGFNESLPL
EVHSSQRYFLFVRIMYSVGYSVSLVFLIMAVAILSLLRRLHCTRNFIHVQLFLSFIFRAV
LIFIRDAVLFSNEDSFHCHIYTVSCKFATVLSNYCIMANYSWLLAEGYYLYKLVSASLFS
QRKHLSWYIILGWGSPVIIMSGWSFAKYLHEDEGCWEMRRSEWIWWILRLPVLLFIVVNL
LFFLCILKILVAKLRTQDMPGNEFSHYRKLAKSSFLLVSLFGLHYILFAFLPHKVRGRTY
EIWNFIELAFASTQGFVVALLYCFLNGEVQNEIQRRWRRWKMKHHVQLEHRRKCGSMSQS
GGGPTNITLLFKSASTPESALV
Download sequence
Identical sequences I3KLJ4
ENSONIP00000021989 XP_013120144.1.78416 XP_019208991.1.78416 ENSONIP00000021989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]