SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022035 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022035
Domain Number 1 Region: 1-228
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.27e-75
Family BAR domain 0.0000000197
Further Details:      
 
Domain Number 2 Region: 261-332
Classification Level Classification E-value
Superfamily SH3-domain 6.96e-23
Family SH3-domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022035   Gene: ENSONIG00000017474   Transcript: ENSONIT00000022054
Sequence length 336
Comment pep:known_by_projection scaffold:Orenil1.0:GL831246.1:646214:652967:-1 gene:ENSONIG00000017474 transcript:ENSONIT00000022054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRVSEKVGGAEGTKLDDDFTVMEKRVDTTARAVMDIITKTTEYLQPNPATRAKMSMMNSM
SRIRGQEKGPGYTQTEVILGEAMQKFGRDLGEESNFGLALIDVGEAMRELGEVKDALDME
VKQNFIDPLQNLHEKDLREIQHHLKKLEGRRLDFDYKKKRQGKVTDDEIKQALEKFDDSK
EIAEQSMFHLLESDIEQVSQLAALVHAQVEYHTRAAEILTQLTSKIDERIKDTSIKPRKE
FVPKPRTSMDFSINLSQNGGVHSARSPARSPAPMDQPCCRALYDFDPENEGELGFKEGDI
ITLTNKIDDNWYEGMLQGNSGFFPINYVDILVPLPH
Download sequence
Identical sequences I3KLP0
ENSONIP00000022035 ENSONIP00000022035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]