SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022089 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022089
Domain Number 1 Region: 394-572
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-54
Family SPRY domain 0.00033
Further Details:      
 
Domain Number 2 Region: 138-202
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.9e-16
Family B-box zinc-binding domain 0.00062
Further Details:      
 
Domain Number 3 Region: 4-58
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000265
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000022089
Domain Number - Region: 324-413
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 0.0144
Family FAT domain of focal adhesion kinase 0.014
Further Details:      
 
Domain Number - Region: 195-298
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0388
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022089   Gene: ENSONIG00000017518   Transcript: ENSONIT00000022108
Sequence length 574
Comment pep:known_by_projection scaffold:Orenil1.0:GL831410.1:450232:454200:-1 gene:ENSONIG00000017518 transcript:ENSONIT00000022108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFDQDTCYLCKEYLRDPVSIPCGHVFCSICLKTYWDHAEHTGSFNCPECRVSYSKRPTP
RRIGGSRHSTLQRNTESFPPPPPSPDYNVAGPQDVGCDICVGKKQKAVKSCLMCLAHYCE
KHLKPHYESATFKRHKLVDEIGHLDRQICPQHQKGLELFCRTDQMCICVLCTVKEHKGHD
MVSAEQERSEEQQRLGATQAEIQERIHDRLKQMEELKHAVDSLKSSAQRALQDCEKMFGD
MMRSIERMQQEMAKLISSNKRAALNNAESHLERLTHEIADLKARDNEITQLSRTEDHIHF
IQSYHMLIAQTEAEELPSVSVNPYFSFGPVTKAVSELKQQLNDSSNDELVKVAKTVNKMT
FCELEDSKKKQYQSIKSDEAPMYKSMPVKEPQYREDFLRYACQLTLDQNTAYRQLYLSRG
NRKAALKRDPQSYPDSPARFDSLPQVLCKEPLSGGTYYWEVDWSGEGASIGIAYKGIKRT
GYGDSCRIGYNRKSWSLFCSDSSYSARHNKDQQEVNAPYSSRIGVFLDHAGGTLSFYTVG
ETMSLIHRFKASFSEPVYPGFWVWYESAITIIQL
Download sequence
Identical sequences I3KLU4
ENSONIP00000022089 XP_003458080.1.78416 XP_019219485.1.78416 ENSONIP00000022089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]