SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022379 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022379
Domain Number 1 Region: 352-650
Classification Level Classification E-value
Superfamily Kelch motif 3.4e-67
Family Kelch motif 0.0000802
Further Details:      
 
Domain Number 2 Region: 86-200
Classification Level Classification E-value
Superfamily POZ domain 4.79e-20
Family BTB/POZ domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022379   Gene: ENSONIG00000017749   Transcript: ENSONIT00000022399
Sequence length 693
Comment pep:novel scaffold:Orenil1.0:GL831441.1:483197:496909:1 gene:ENSONIG00000017749 transcript:ENSONIT00000022399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKKKASRPKKAAVETISQVAMEAVSATLKVENRGDGVVVMESGVKKIEQMAALDIAQL
NSLNLPLPPPVIKPGERGLGLGSELTRPLHGNALLEELSKMRQEKFLTDLELACKTKAFD
VHKLVISSVSQYFREILAKDPSMKRLELPSLSPLGLANVITFAYLGRVHMSLYTISCTVS
AAATLQIPQLLKMCVDFLLAELNVQTCVYIWNIAAAYGLLPVCDAARRFVLENFVQFAET
PLFNQLTLEQISAFLQDDSLLLPSEVTAFKLAMKWLDFDASRQVHAAELLSHVRFETIPA
SELVSQIQPVPRMMQDPQCHRLLVDAMNYHLLPYQQNTLQSRRTQVRAGHQTLLIVGGRP
SLTERALSREVLWRDPRDGGATWRHLTQLPAKSFNQCVAVMDGFLYVAGGEDQNDARNQA
KHAVSTLSRYDPRFNTWLHLASMRQRRTHFSLAASGGRLFAIGGRNVEGLLATSESYLPS
SNTWQMRAPMEMPRCCHASATLPSGDILVTGGYINCAYSRSVACYNVETDTWTEKPPMET
PRGWHCSATVGGKVYVVGGSQLGPGGERVDVLSVEVYSPESGSWSRAAPLPLGVSTAGLS
SLAEKLYLLGGWNEAEKRYKAAVQKYDPATDSWSMAEDLPEPTVGVSCCTLTLPHRQTPR
RQHRNTPGHEDQQQAAKNRSRESSTSPSQSTTA
Download sequence
Identical sequences I3KMN4
ENSONIP00000022379 ENSONIP00000022379 XP_003458597.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]