SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022560 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022560
Domain Number 1 Region: 380-549
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-53
Family SPRY domain 0.00052
Further Details:      
 
Domain Number 2 Region: 8-80
Classification Level Classification E-value
Superfamily RING/U-box 4.48e-20
Family RING finger domain, C3HC4 0.0093
Further Details:      
 
Domain Number 3 Region: 140-173
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000167
Family B-box zinc-binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022560   Gene: ENSONIG00000017901   Transcript: ENSONIT00000022580
Sequence length 560
Comment pep:novel scaffold:Orenil1.0:GL832029.1:12138:22580:-1 gene:ENSONIG00000017901 transcript:ENSONIT00000022580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQHRVDQAEISCSVCLYLLKDPVTIPCGHSYCMNCIKSFWDEEEKKKIYSCPQCRQTFT
PRPVLVKNTMLADLVEELKKTGLQAAPADHCYAGPEDVACDVCTGRKMKAFKSCLVCLAS
YCEKHLQPHYDSPTFMKHKLVEPSKKLQENICSRHDEVMKMFCRTDHRCTCGLVFCLLVE
SYLYDCQSKEGERKEGTVRREYKVRKNQVRKQTGNSDRHKIKIFFLHSIHCTIGKGASIY
LMVLLHTFKNCSLDVSEFLKEIFPVTVYGGYHCSSSFSFTKIFLHMKIGDHLWPLGGLVT
HTQKDVDFFKEFMLPVLTRLPNLVKPHDDTVTERDDSLVKMRICRCNIWNTEIRICKQIY
LVNIKIKKTGDPPEPKTRAGFLKYSCEITLDPNTAHKQLLLSEGNRKATRMNQQQSYSDH
PDRFTVWHQVLSRQSLTGCCYWEVEWRGGGVQVAVAYKNISRAGSGTESKFGCNDKSWAL
ECNNSSYTFWYNNIETPVSGPRSSRVGVYLDHRAGILSFYSVSETMTLLHRVQTTFTQPL
YAGLSLYTDIWGNFKTDAEL
Download sequence
Identical sequences I3KN65
ENSONIP00000022560 ENSONIP00000022560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]