SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022561 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022561
Domain Number 1 Region: 372-541
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-53
Family SPRY domain 0.00052
Further Details:      
 
Domain Number 2 Region: 8-80
Classification Level Classification E-value
Superfamily RING/U-box 4.24e-20
Family RING finger domain, C3HC4 0.0093
Further Details:      
 
Domain Number 3 Region: 140-173
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000163
Family B-box zinc-binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022561   Gene: ENSONIG00000017901   Transcript: ENSONIT00000022581
Sequence length 552
Comment pep:novel scaffold:Orenil1.0:GL832029.1:12138:22580:-1 gene:ENSONIG00000017901 transcript:ENSONIT00000022581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQHRVDQAEISCSVCLYLLKDPVTIPCGHSYCMNCIKSFWDEEEKKKIYSCPQCRQTFT
PRPVLVKNTMLADLVEELKKTGLQAAPADHCYAGPEDVACDVCTGRKMKAFKSCLVCLAS
YCEKHLQPHYDSPTFMKHKLVEPSKKLQENICSRHDEVMKMFCRTDHRCTCGLVFCLLVE
SYLYDCQSKEGERKEGTVRREYKVRKNQVRKQTGNSDRHKISYDLIKKFADLHRDVLLSC
FRQVLHSSPPSPHFTRLLPRAVTSTALSDLWNRSHTVSLRVVGDHLWPLGGLVTHTQKDV
DFFKEFMKGSNFTAVVKPHDDTVTERDDSLVKMRICRCNIWNTEIRICKQIYLVNIKIKK
TGDPPEPKTRAGFLKYSCEITLDPNTAHKQLLLSEGNRKATRMNQQQSYSDHPDRFTVWH
QVLSRQSLTGCCYWEVEWRGGGVQVAVAYKNISRAGSGTESKFGCNDKSWALECNNSSYT
FWYNNIETPVSGPRSSRVGVYLDHRAGILSFYSVSETMTLLHRVQTTFTQPLYAGLSLYT
DIWGNFKTDAEL
Download sequence
Identical sequences I3KN66
ENSONIP00000022561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]