SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022782 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022782
Domain Number 1 Region: 426-600
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-47
Family SPRY domain 0.00037
Further Details:      
 
Domain Number 2 Region: 177-241
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000168
Family B-box zinc-binding domain 0.00057
Further Details:      
 
Domain Number 3 Region: 17-58
Classification Level Classification E-value
Superfamily RING/U-box 0.00000825
Family RING finger domain, C3HC4 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022782   Gene: ENSONIG00000018081   Transcript: ENSONIT00000022802
Sequence length 626
Comment pep:known_by_projection scaffold:Orenil1.0:GL831200.1:770853:781643:-1 gene:ENSONIG00000018081 transcript:ENSONIT00000022802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADTAAVEVAPLPKQQQQQNLCGVCSGKPSGEEPAACGHSVCGSCLEGKSKGCPQCPVKP
GSPKQNGTADPPVNKTSENQSQESKTAEETKIQEDLKESEDPKKPEEDKKEAEPQTEEGP
KEDQDKEEPLGPDDVVCDSCIENPRRALKSCLTCLVSYCEAHLRPHLENPKFQNHRLVDP
LRDIERRTCESHKWPLDLFCSTDSCCICQDCVNEDHKGHNTVSVVEARNQIENELREKQT
EMMKTVTAAENAINKLQLNTVSIEQSVKDVRAVIESQFEELQAVVEKAKKEVTEILEGEE
KQALQQAEGIRVHLEQRCTDLKKTQVQMEKISKNKNDVDFLQEYAEWKKEAADISLPGVY
IGLMDCLNAFSRVIVDSTQELCAMLVSSYIDKVKETCKSDKVGIKTTVKAIAAAKYIKSL
PDPVTRADFLKYAAQVSFDPVTAHKFLRLMEENKKVTNTTPWQHPYPDVPERFENWRQVL
AVESFYMGRHYFEADIHGESTHVGLTYKSLDRKGNESNSCITGNSFSWCLRWNGRNFSAW
HCDVETPLNVEMFSRIGVYVDYTQGLLAFYGVGETMTLIHKYQTEFLEPLYPAFWLPKKE
NTVLLVAPGEPLPPKTPSPPTSPTTE
Download sequence
Identical sequences I3KNT7
ENSONIP00000022782 ENSONIP00000022782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]