SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023334 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023334
Domain Number 1 Region: 182-393
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.9e-51
Family DBL homology domain (DH-domain) 0.00000041
Further Details:      
 
Domain Number 2 Region: 2-228
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-40
Family Calponin-homology domain, CH-domain 0.0038
Further Details:      
 
Domain Number 3 Region: 380-541
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-33
Family Pleckstrin-homology domain (PH domain) 0.0056
Further Details:      
 
Domain Number 4 Region: 632-762
Classification Level Classification E-value
Superfamily SH2 domain 7.47e-28
Family SH2 domain 0.00078
Further Details:      
 
Domain Number 5 Region: 783-840
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-21
Family SH3-domain 0.00099
Further Details:      
 
Domain Number 6 Region: 587-660
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000134
Family SH3-domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023334   Gene: ENSONIG00000018535   Transcript: ENSONIT00000023354
Sequence length 842
Comment pep:known_by_projection scaffold:Orenil1.0:GL831198.1:2171288:2223521:-1 gene:ENSONIG00000018535 transcript:ENSONIT00000023354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYWRQCAMWLISCNVLPANHRVTADTAQVFDLAQTLRDGVLLCQLLNNLRPHTINLKEI
NLRPQMSQFLCLKNIRTFLASCCDVFGMKKSDLFEAFDLFDVRDFGKVMDTLSKLSHTTV
AQQAGFKPFPTDESLQNEDIYNNLEDMIDESVPEDEDDLYAAVYGLEDDYAGGEIYEDLM
RTEQPPPLQAEVDIRSCCLTEIKQTEEKYTETLESIEKYFLNPLKKFFSTVEIDKVFVNI
PDLVRLHKSLMAEVQDSILNKNALNLYQIFISYKERLLIYGIYCSRVEIAIAVLDLICKE
KEDVRLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTQDAADKSNLKIAL
DAMKDLAQYVNEVKRDNETLREIDQYQRSIENLNTPLVTYGRPKGDGEVRIVSSVDKKKQ
DRHIFLFDVAVIVCKRRGDNYEMKDILDLNYFKITNNPTSDRECKKWCYGFYVTHQQGHT
GFELFFKTRELKKKWLDQFEMAISNIRPEKATHNSHHFKMHTFERITSCSFCHLLLRGIF
NQGYLCLKCGLGAHKECLGRLGVCGRTAVSHLTAEPVKLRPKDNTTPADPGLPRMVVIRD
YSGIPSSQCGTPLSIHVGDVIELMFADLQSFWWQGKNLATSKIGFFPSDAVRPCPCVPKP
VDYSAQLWFAGPMERCQAEVALLDRENGTYLIRHRSKECTEYAISIKFNDKVKHIKILTK
DGGFYIAETRVFKTVLDLVEYYQQHSLKEGFSSLDTTLQHPYREQPNGNMPTAITKVGSV
FSPRVVGYAIARYDFCSRDTRELSLQQGDVITIYTKMPNGWWKGVVGDRVGWFPSTYVEE
ED
Download sequence
Identical sequences I3KQD9
ENSONIP00000023334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]