SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023419 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023419
Domain Number 1 Region: 305-482
Classification Level Classification E-value
Superfamily Kelch motif 7.32e-47
Family Kelch motif 0.0000832
Further Details:      
 
Domain Number 2 Region: 33-149
Classification Level Classification E-value
Superfamily POZ domain 7.5e-38
Family BTB/POZ domain 0.0019
Further Details:      
 
Domain Number 3 Region: 454-600
Classification Level Classification E-value
Superfamily Kelch motif 5.62e-36
Family Kelch motif 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023419   Gene: ENSONIG00000018606   Transcript: ENSONIT00000023440
Sequence length 601
Comment pep:known_by_projection scaffold:Orenil1.0:GL831264.1:405766:410196:1 gene:ENSONIG00000018606 transcript:ENSONIT00000023440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSISVSTSSGCSRNAGAAAMATQGLEQAVLASDRYARLILAQMNKMRLRSDFCDVGLKV
GGRVFKVHRLVLAASSPYFSALFAGGMREADKEEVQILGVDTDVFEILLEFIYTGVISVT
VENVQELMVAADMLQLNEVVSICGEFLKGHMDPSNCVGIFQFLEQIACMDMLEFTENYIH
VHFLEVCVTDEFRGLSKEQLVRLLKSEELRIEDEYQVFTAAMEWVLQDVAKRKKHVVEVL
EPVRFPLLSPQRLFKYIEGITDFSLRVALQTLLREYTEVTKSPKENKMYSQLQPAKMRPR
RKARKYLYAIGGYTRLQGGRWSDSRALSCVERFDTFNQYWTTVSSLHQARSGLGVAVLEG
MIYVVGGEKDSMIFDCTERYDPVTKQWAAVASLTFPRCGVGVCPCHGALYALGGWIGSEI
GKTMERYDPEENKWEVIGSMAVPRYYFGCCEFQGFIYVIGGISDEGMELRSAEVYDPISR
RWSALPVMATRRAYVGVACLNNCIYAVGGWNEALGALETVEKYCPEEEKWVEVAAMSTAR
AGVSVSAVNGLLYAVGGRATTRDFSAPVTVDSVEIYDPHLDTWTEVGNMITSRCDGGLAV
L
Download sequence
Identical sequences I3KQM4
XP_003453357.1.78416 XP_005458101.1.78416 ENSONIP00000023419 ENSONIP00000023419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]