SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023498 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023498
Domain Number 1 Region: 136-413
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.7e-73
Family Protein kinases, catalytic subunit 0.000000002
Further Details:      
 
Domain Number 2 Region: 409-462
Classification Level Classification E-value
Superfamily SH3-domain 0.000000002
Family SH3-domain 0.0021
Further Details:      
 
Domain Number 3 Region: 1073-1118
Classification Level Classification E-value
Superfamily UBA-like 0.000000268
Family UBA domain 0.077
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000023498
Domain Number - Region: 7-69
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0408
Family SAM (sterile alpha motif) domain 0.0088
Further Details:      
 
Domain Number - Region: 1119-1157
Classification Level Classification E-value
Superfamily UBA-like 0.0608
Family UBA domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023498   Gene: ENSONIG00000018667   Transcript: ENSONIT00000023519
Sequence length 1164
Comment pep:known_by_projection scaffold:Orenil1.0:GL831264.1:1211696:1270038:1 gene:ENSONIG00000018667 transcript:ENSONIT00000023519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQCEEGTEWLLELLMEVQLQQYFLRIRDDLNVTRLSHFDYVKNEDLEKIGMGRPGQRRLW
EAVKRRKAMCKRKSWMSKVFSGKRPDGGDVPQQGQPASSFRKLSPTPPLGVGEGVLVTQP
SGGALLDGQQQGLTCLIPEKDLTLFEKLGDGSFGVVKRGEWLTPAGKVLNVAVKCLKTDV
LSQPDALEDFICEVNVMHSLDHQNLIRLYGVVLTHPMKMVTELAPLGSLLERLRCVRPQG
PVLIHTLCQYAVQVACGMAYLEQRRFIHRDLAARNILLAAAHRVKIGDFGLMRALPNNHE
HYVMQEHRKVPFAWCAPESLKTRTFSHATDTWMFGVTLWEMFTHGQEPWLGLNGSQILHK
IDKEGERLPKPEDCPQDIYNVMLQCWAQKPDDRPTFVALREFLLESMPTDMCALQDFDEP
DKLQIQVDDIITIIEGRAENYWWRGQNKRTLKVGQFPRNVVTSVAGLSAHDISRPLKNSF
IHTGHGDTNPHRCWGFPDRIDDLYLGNPMDPPDVLGLDLSAAQPTQLAGRAKKPSYDPVN
EEEDLTSAGLKRLSLRKTGSVKGLKLKPAVWVSASKQGGGRTSGSGQNTNSEVSLIDFGE
EYPISTPSPSPVVEIPIPLLAKLALEAENLLDRTPPQSPSKSLPRPLHPTPVVDWDARPL
PPPPAYDDVAQDEDDMEVSSINSSEQQNEAEHSDGLNPEETLSSGQKVNDEALVSRGSDR
PGLEDNLFLPSNHSQGLSTSFSQSAEIFQELQQECMRRLNVPAASAPRSCSPLQSSVLCP
QTLQSPQTHEGQQQSVLSCNEDRPQIPPRVPIPPRPMKKGDYTSGRWSRDLSLSPVPTET
TENVSGAGQERPPQIPPRDPLSQPGSRTPSPMGLVVGSPQQRLYSVSPNTMQAAITTCPP
THTYSSYLSTSPGKLMPTTHSFASDPKYAAPKVIQAQVQGKDAASKGPCILPIVRDGRKV
SNTHYYLLPERPPYLDRFDRFFREAESLPANDVEEKHVRQANTATVRPMVVGSHTLQGHT
QVQVQPGGDLKANFSSNNNSNLGWPRSGMKSSVSLPRVCSDGLTAPAVTAFCTRTDGGAN
SADRVKMVQEAVHGVTMEECQAALHNHNWNVQQAVHYLKVEQLFCLGLRSRSECLKLLEM
CDWNLEVASTHMLDNYGSTTRQRR
Download sequence
Identical sequences I3KQV3
ENSONIP00000023498 ENSONIP00000023498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]